Various Artist [Hard] mp3, A Tribute to The Beast free mp3 download
Various Artist [Hard] free mp3 download, A Tribute to The Beast download mp3
Various Artist [Hard]
wave gotik treffen 2002
. highway to hell, becoming [pantera cover] (gooseflesh) - une saison en enfer (the ocean), other fools / so fucking why, camilla's masque (cradle of filth) - kleiner leuchtender stern, windfall introducing summoning of the muse (hortus animae), pretty fly (for a white guy) - in the heart of juliet (liv kristine) - can you feel the sound (the horrorist), new york groove (bruce bouillet). burning coast (glazemaker), my enemy, space (something corporate), she is out of my love (michael jackson), stormchaser (dungeon) - eyelash (big electric cat) - the clash - should i stay or should i go, filter - where do we go from here. thus march the nightspirit (emperor). elysium - 4.48 for sarah, dim the light (my fate), one shot (godiva), behold judas (hate eternal) - queen - we will rock you. shake your blood (probot feat. dave grohl) - murders in the rue morgue (in flames). warpigs (vital remains), seal - kiss form a rose - witness my... (the dead) (respawn), the kids aren't alright, der untergang (stillste stund), my kantele (amorphis), children of the sea [jag panzer], witchery - riding on the wind, savage (brainstorm) - no return (avantasia) - your master is calling (pink turns blue). pale forest - taller, yet smal. stereo motion - tip of my tongue, nokturne l.a. - raining blood. let go (midtown). mein herz (heartbreaker rmx by blutengel) (staubkind), drown (the silence). hammerfall (hammerfall), under god, uusi aatami, uusi eeva (mokoma) - controlled madness - v's theme, you shook me all night long. schweben, fliegen und fallen, du gehst (other day). love (strapping young lad), welcome to the conic section (zeenon). iscariot (cradle of filth) - the three shadows(part ii). day (katatonia) - slukad (the abyss). leather strip - for whom the bell tolls - still i'm sad [axel rudy pell], walk all over you, up to the limit (live) (accept) - toxic (crazy town), gates to the outside (antaeus) - willenskraft (atrocity). james last - morning. hand of doom (cephalic carnage), clearance of century, phantom of the opera (new eden) - little wing, backslide (sleazy dream) - running after you (heaven's door), symbol of disgrace (pyogenesis) - kashmir - mats leven - broken vow, the illusionist (scar symmetry), rob zombie - superbest, creed - wrong way, metal militia - exmortem - showdown (barcode), killing in the name of, convicted in life (sepultura), fried genitals (dawn of disease). mimic47 (diablo). sugar (kittie). the doomwatchers perdiction (afflicted) - zaglada krolestwa (moloch) - desillusion (escape with romeo). untot - warhead [the producer's mix] (venom). letters to you (finch), i miss you (blink 182). shock me (gilby clarke), the byrds / ballad of easy rider. one final graven kiss (cradle of filth), s.o.s. (paradox), rainbow theme-frozen rainbow (solitude), venus in fear (cradle of filth), perfection or vanity (dimmu borgir). i can't feel you (camouflage) - building up a ruin to come (fallen yggdrasil), vermachtnis der sonne (lacrimosa), evil (live) (snowy shaw) - der morgen danach (metus version) (lacrimosa) - ever so sweet (the early november). c'mon and love me (smalltown rockets) - fist fuck death grip (xxx maniak), nightdream (evoke thy lords), elegy (scream silence), sum 41 - its what were all about. the mystical gate of reincarnation (kataklysm), coitus per machina (mental demise), opeth - the grand conjuration [edit] - pride (soil) - should i stay or should i go. for whom the bell tolls (spew). altar of the gods (angelcrypt), we won't be open to fall. woman in love (barbra streisand). testify (the minstrels), scar symmetry / the illusionist (various), reduced to a limbless sexslave (artery eruption). cold victim (thine eyes bleed) - time to break up, down rodeo, the night of the triumphator (performed by satyricon), too late for love [def leppard cover] (crease), always with me, always with you (bruce kulick). the sound of names dropping (stretch armstrong), inn i evighetens morke, part 1 (dimmu borgir), equimanthorn (dark funeral). more than words (extreme). in the end (pod people) - walk away (paradise lost). demigod (behemoth), como poden (in extremo) - wild frontiers (daniel flores and friends). linda ronstadt - love me tender, crusader (mighty d), lugner (funker vogt) - headed for a heartbreak (winger) - hordagaard - jesus' tod, europe - the final countdown - cleansweep (face down), at the end of august (36 crazyfists), learn-love-hate (fatal smile) - thernal noise (statemachine) - rainbow in the dark (dio) - killtank (bleed the sky). from the cradle to enslave (dark army) - blades to laughter (night in gales), command of the blade [kreator cover] (krabathor) - martyrs for diabolical summonings (adumus), the lotus eaters (imperia). queen of winter, throned (cradle of filth). follow the blind (jormundgard) - one - ungrateful, kiss me deadly (lita ford). you will remember tonight (andrew w.k.), age of innocence (adair), one thousand days in sodom (sodom). those beyond (the legion), darkane - restless & wild, anyone, anywhere (anathema) - siamese twins (spiders & snakes) - a forest [the cure cover] (carpathian forest), breathing stardust (sinessence) - breathe (seven channels). god called in sick today (the independents), please don't go (warchylde). hammerfall / secrets (various). the killing kind (performed by gehenna). diabolus absconditus. wrathchild (sadist), dzikich kaplanek wielki dzien (sabat) (beleth). shout (atrocity), the wizard (bullring brummies), dimmu borgir - broderskapets ring, friends (duke). dreadful shadows / dissolution - forgotten realm (sad), seikilos (corvus corax). david bowie - ziggy stardust - bohemian rhapsody - flaming lips, just got paid, pernicious (mincing fury and guttural claumour of queer decay). mushroom hell (cerebral turbulency) - colliding worlds (black majesty). a vulgar picture (the black dahlia murder) - highway to hell (turner, joe lynn / richie kotzen / tony franklin). senses fail - lady in a blue dress, vernichtung - samael (stigmata), chainsaw slaughter (gored face), salt rock eyes (circle of dead children), dead in a web (some girls). moon over kara-shehr (emperor), hollywood babylon (gazua) - shadow - the reunion in soul asylum. mikael erlandsson - going home - wango tango (ted nugent). heart is crying (dionysus) - lost in time (dgm) - windmilles of tour mired (fausto papetti), the graveyard by moonlight (cradle of filth). escalator (sam gopal). holy diver (holy moses) - der triumph des herzen (samsas traum) - tool of the devil (thunderstone). blue skies bring tears (gaza). nosferatu (bloodbound), take it away. w.a.s.p. / wild child, everlasting life (symphorce). jump in the fire - dee dee ramone. the sons of the dragon slayer (blood eagle) (rebellion), temple of fire (power quest). hind sight - the starting line - playing fa, times gate (arwen), dio - lord of the lost day, war pigs (live) (black sabbath). bryan ferry - let's stick together, babys got a tamper (prodigy). the final countdown (europe), midas in reverse (breather resist), to cold void desolation (performed by neptune towers). paul butterfield blues band - love march. leaves scar (amorphis) - until it sleeps - sbi. on the edge (spetsnaz). beware of the devil (impellitteri) - morbid gladiator (raven black night), t.a.b.o.b.a. (koroded). crematory / shadows of mine (live). my faith in you (mordorn) - flyin' high again (vile), death to the false (skelator) - hell on earth (retrosic mix) (aslan faction) - burnin' up (doom squad). hello spaceboy [david bowie cover] (behemoth), wrapped dead inside (transport league). hail and kill / manowar, here without you (3 doors down), tears of time (deutsche versio (crematory), forget about you (the motors) - staple - the songwriter, babe (take that), hoobastank - running away - voulez - vouz (morgana lefay). self medicate (40 bellow summer). electric funeral (jesters of destiny). backwash / one more dollar. the fall of the spiral (domine), is this love, arkanar (arkanar), how fortunate is the man with none, la grange - life or death (start raving mad) - wave of mutilation (superdrag) - pain / on your knees (again). run (snow patrol), pet shop boys - always on my mind, salieri strikes back (warmen) - the mad ones-mama i'm coming home, maximum rotting corpse (butcher abc), this flight tonight [nazareth cover] (iron savior). ever dream (nightwish). rise (bleeding through) - the thing that should not be (primus) - girl of 18 summers (18 summers). the element - nothing else matters (elemental mix). back to decadence (g.a.s.), you're crazy [guns 'n' roses cover] (haste). saliva - your disease, nightwish - bare grace misery, kreatur (fahr zur holle) (plastic). bleed the day (hevein). imperium (machine head) - borstal breakout (sham 69) - south of heaven - rip it out (scott ian) - thursday / for the workforce, drowning, dried up, tied, & dead to the world (needulhed), jimi hendrix - star spangled banner - purple haze & instrumental solo, blackout - stevie rachelle. someone to believe (lana lane) - engraved within (serenity) - feel like makin' love (bad company), zeitsprung (megadump). take a chance on me (rough silk) - midnight oil - beds are burning - rip ride (forbidden). dr feelgood - milk and alcohol, p.o.d. - boom, seventh seal (italy): "flee from reality" (metal church) - seasons in the abyss - upon azrael's wings (edit) (cathedral) - battery (re-filtered by filter section) (die krupps) - write my name in blood [exclusive] (burning retina), neon knights (steel prophet). moonchild (necrophobic), kids in the way - moving mountains, beast and the harlot (live) (avenged sevenfold) - opeth - ghost of perdition (edit), just one fix (heavy water factory). food for the gods (in flames). brutal truth - average people - nephasth - war ensemble - behold the hand of glory (powervice). la salle noire (single whip ed (carlos peron) - t.v. casualties (tanner) - wire - outdoor miner, kiss of death (pure rubbish), iggy pop - the passenger, house of pain (faster pussycat). manta ray (teens heroes) - game of fear (royal hunt) - numb (gothacoustic ensemble) - n.i.b. (primus and ozzy osbourne) - lucretia (my reflection) (the sisters of mercy) (kreator) - horror of antarctica (the vision bleak), spirit city (sacrilege), careering (public image ltd). eagles become vultures (converge), don't close your eyes (kix) - hell ain't a bad place to be (jizzy pearl / jennifer batten / tony franklin). lacrimosa / alleine zu zweit, deliver the axe (panther) - panama (van halen), waterloo (nation) - the saints - this perfect day, darkness waves with many shades (cinis) - play it hard (tracy gang pussy), in the wake of adversity (arcana). the holiday song (the siren six!), columbian necktie (front line assembly), interior crack psycho angel bitch (malicious secrets) - judas priest - living after midnight - flybanger - blind world. you broke like glass (eighteen visions). start the ice age (the copperpot journals). the unforgiven (doug pinnick/vernon reid/tony franklin/frankie banali), face of death (fsk 18 mix). beyond the dark sun (wintersum) - motherzone (deathstars) - farewell (kamelot), 1000 days in sodom (sodom). break me (entwine) - silent lucidity (queensryche), unevangel (exordium). in power we entrust the love advocated, die hard (nuclear assault). henchman (flakes), my friend of misery (dark tranquillity), that's what i know (brain failure). helloween / mrs god, sentenced / noose - five for fighting - superman, gilded cunt (cradle of filth) - the farewell (antichrisis) - rod stewart - have i told you lately (that i love you) - darkane - powerslave. psychoanalytic (dulce liquido). dreamland (dreamtale). radio explodes (this drama) - to eve the art of witchcraft (born of thorns), james labrie / a time and a place (trent gardner), love goes a long way (maxeen) - winter madness (wintersun). vertical horizon - you're a god. the attitude song (richard kendrick). countess bathory (candlemass), cryin (paradise alley), traurige nation (armageddon dildos). folge mir ins licht (melotron). wir warten auf den tod (mantus) - desire (panther) - crazy little thing called love - josh kelley - step away (mister manic), last breath (morbid death) - whispers (warchylde) - ravishing grimness (performed by darkthrone). willie nelson - heartbreak hotel, my sharona, hel - goddes of the underworld (hagalaz runedance) - te amo...i hate you (ill nino), poison, die brut 2000 (goethes erben) - terror couple kill colonel, shot for shot (tantrum). bomber (mother superior), massaker (tommi stumpff). engrave - evil has no boundaries. revenge (dessau), dance the night away. das ich im ich (and one remix) (das ich) - infest (papa roach). an american hero (mark knopfler) - immortality is mine (withered beauty), darkness... (an eternity) (satyrus) - touch my life (phenomena), slaughter in the vatican (exhorder), one way street (lou ann barton) - run if you can (watchtower), ingvie malmsteen - trilogy suite. foxey lady - bombtrack (sinus giddy) - purify (lacuna coil) - defy you. dr. feelgood (rewind). apple shampoo (acoustic). behind the wall of sleep [black sabbath cover] (static-x), zlovonic black (unplugged) - bombtrack - back where you belong (38 special). die in fire (nifelheim) - 1000 crimes [exclusive] (absinthe), paint it black [rolling stones cover] (rage), propaganda arktika (vulkan bondage). dragonforce / through the fire and flames, if ever (acoustic) (gratitude) - it's all gone (extraction mix by god module) (project-x), request denied (hypocrisy). holy wars (the punishment due), mind energy (radio edit) (intertia). victoria's secret (sonata arctica), road to melnibone (stuart smith) - dragons lair (goddess of desire) - die die my darling (mofo), cephalic carnage - cryptosporidium - the beast within you (lana lane). vision of equal psychosis (corporal raid). the philosopher (leukorrhea) - neavens is falling (blender), niemand kennt den tod (erben der schopfung). confined (as i lay dying). summoning of the muse (deconstructed), jesus saves, nicolas de angelis - la dance du sabre, warriors of death (mystifier). isn't it time (slow motion reign) - she's in parties, caliban / arena of concealment. another return (midnattsol), goodbye (night ranger) - she wolf (abhorrent), iv tomb (hematoma). cathedral in ice (fahrenheit 451). hatestone (edit) (enemynside). the face of god (pearls and brass), path (vol.2) (apocaliptica feat. sandra nasi) - gottmensch (schock) - the hellacopters - by the grace of god. north coast love song (nothing less). in the flat field - goodbye to romance (lisa loeb / dweezil zappa / mike porcaro). crawling (fredcos demon version) - sham 69 - if the kids are united. new sensation (neuroatcive) - somniae status (italy): "i don't believe in love" (queensryche). servants of the warsmen (winter). jefferson starship / ride the tiger, my flesh consumed (human bloodfeast). rainbow - difficult to cure - rise and fall, ghouls night out (goldfinger) - blue suede shoes (lemmy & the upsetters with mic) - tausend sterne (manipultaion). owner of a lonely heart. bloodpath (symbiontic) - parallax (parallel), dark - touch to much - straight through the heart (mad margritt) - sabbath bloody sabbath (alberto salerno). god complex (pyogenesis) - and the story ends (acrimony). the faster the better (sworn). the cardigans - eraserewind. gewissen (letzte instanz) - wild side (needulhed), fool for your loving (whitesnake). i want out - in transit (for you) (matchbook romance), my plague (slipknot). trompe le monde (braid). right side of the bed (atreyu). the calling - wherever you will go. nemesis (arch enemy) - poison (alice cooper), take this life (in flames). the only ones - another girl, another planet, black sabbath / headless cross - opeth - ghost of perdition (edit) - tierra santa - flight of icarus, sammy hagar / i can't drive 55. therion - children of the damned. hoobastank - crawling in the dark - ich gab dir alles (lame immortelle) - us and them - electric renaissance (performed by satyricon). big brother (velcra). carved inside (soulfly) - listless (on broken wings), burn (whitesnake) - bloodprints. cure eclipse (36 crazyfists). gone away - teufel an der wand (sanguis et cinis). my name is silence (madder mortem), bitterkei (l'ame immortelle), sunshine again (blackfoot), links 2 3 4 (rammstein), summer song (brad gillis). the end of heartache (killswitch engage). message in a bottle (police) (machine head) - motorbreath - sarcazm, sleep now in the sun (atwater). nothing going on (clawfinger), die! - p.o.d. - alive, static-x - cold. out in the fields (iron mask) - sure got cold after the rain fell - we rock (grave digger), supernaut - lost (visions of atlantis), sick happy (hell is for heroes), falling (machine men). dredg - same ol road, winter (floating point rmx) (wave in head), hellraiser (motorhead), diamonds and rust (joan baez) (thunderstone) - glassjaw - cosmopolitan blood loss, fatherland [sisters of mercy mix], blind in texas [w.a.s.p. cover] (battagia). my house on mars (ayreon), moonlight mile (alvin "youngblood" hart), dirty deeds done dirt cheap (mark slaughter / doug aldrich / tony franklin) - new abortion (slipknot) - make it count (the change) - hand of doom (slayer). it's dangerous business walking out your front door, master of puppets (burden of grief). therion - green manalishi - rebel yell [billy idol cover] (children of bodom) - velouria (weezer), i can't explain (the bollock bros). same ol fuckery (the black league), irresponsible hate anthem (american head charge). reo speedwagon - take it on the run, vstalnyh grozah (stalnoy pakt), can i play with madness? - mark slaughter. the flys - love & a molotov cocktail. sleep (hematoma). danger (panther) - deathcrush (ophthalamia) - enter sandman - vice squad, emmanuelle (fausto papetti). paradise city [g'n'r cover] (eighteen visions), papercut (linkin park), this is the new s**t (marilyn manson) - guano apes - dodel up - tumblin' dice (johnny copeland). #4 (benedictum) - 1969 (the mission uk/wayne hussey), the evil that men do (naglfar). the eternal plague (requiem laus). 7 seconds (love like blod), jipp [#]. united to be famous / sun of my soul. dimmu borgir - broderskapets ring. cradle of filth - hallowed be thy name - no others (full blown chaos), the damned - neat neat neat. blind guardian / ashes to ashes. wormwood (tristania) - you knew what this was - 999 - emergency, in it for the money (stampede queen), escape (in extremis) - hateful design (graveworm), luciferion - fight fire with fire - pariah (tomorrow and forever). eddie vedder zeke - daytime dilemma (dangers of love) - still of the night - painkiller (mech) - bonus track - bonus track. siebenburgen - rebellion - wicked game (h.i.m.). one day women will become monsters (chiodos) - lynyrd skynyrd / that smell. the kids arent alright (offspring) - highway is coming to get you (live) (highway chile). guerrilla radio (jimmy and the tercels), american madness (chris liebing), parasite (doug pinnick). why don't you get a job, military man (eric sands) - jane (the loved ones), 16 down - heaven still cries - you know i wanted just to take you home, but that's not your style, 2003
2004, country girl (dan swano & peter tagtgren) - me against the world (simple plan) - immigrant song - crazy crazy nights (kurt nilsen), het hreken van boeien. original prankster. break it (gram positivo feat. daniela "peixinho") - fuel for hatred (satyricon), seven seals (primal fear), pushing me away (dark one), grave digger - running free, the trooper (lord belial). the passion of lovers - to breathe and to suffocate (ablaze in hatred) - zauberschloss (in strict confidence) - vacant (eight fingers down). sigviskriff (vondur). breathe (albert react). touch the flames (stormwind), believe (edit) (cleen) - witching hour (kreator), memory's garden (cristitia) - bullet in the head - the kovenant / new world order (clubmix), (the) ninth key (ccf) (this morn' omina). wake up in hell (maroon). dumpweed - snook / loo dream, hand of blood (bullet for my valentine) - surreal (edit) (vanishing point), hall of pain (blind passengers), the rising end (zao), eric clapton - tears in heaven - der almanach 2000 (der liederkranz). just one fix (meg lee chin), rammstein - feuer frei - renegades of funk, spirit (persephone) - chelsea - right to work - take my breath away (berlin), steel prophet - the ides of march / purgatory, rondo veneziano - musica fantasia. anarchy (mateba), living in a lie (guano apes). outro, shes got balls - meaning in tragedy (as i lay dying), i am for you, boy hits car - lovefurypassionenergy (lita's theme) - blind light - inside out (eleventh hour), pearl (extol). armia drevnih, soul asylum (destroid) - rise and fall (criminal), denim and leather (torment) - burning earth (firewind), schwarz (asp) - in this garden of mine (fading colours), vanessa mae - hocus pocus, the inner truth (rising faith). back in a moment (angelzoom). anti christ. a hamlet for a slothful vassal (theatre of tragedy), goddess (acid reign) - trenton city murders (tantrum) - kein kompromiss (dark voices). goo goo dolls - here is gone - i dont think they know (mesh), hungry for heaven (live) (dio) - strange ways (kiss) (hypocrisy), killing joke - war dance, the fight, generator (candysuck) - everyday sunday - lose it again, beecher - function! function!, procreation of the wicked [celtic frost cover] (enslaved) - intro (christopher lee) - hellraiser (turner, joe lynn / steve lukather), sin city. sugarcolt - memory - erkaufte traume (goethes erben), when u dead man walks. calling doctor love (page hamilton). dark chest of wonders (nightwish) - over the top (crank county daredevils), child of the nile (magic kingdom). you are not unique (one mix) (aiboforcen), system of a down - metro. sweet leaf (agent steel), ride on tears (charon) - best for you (toast) - in the glare of burning churches (arkona). hunting song (korpiklaani), die grosse leere (dracul). epidemic. chains of disorder (demisor). once in a million years (wenn aus liebe sehnsucht wird) (blackmore's night). holiday - paul shortino. in rememberance of a shroud (dismal euphony), farll of serenity / as i watch (demo version), paper hanger. lost paradise (nightfall), rime of ancient marinated corpse (kutabare), schwarze witwe (eisbrecher). withered / within your grief. i'll cry for you (europe) (edguy). il miraggio (cmky). those who left those who stayed (murder by death). drawn to the flame (thunderstone) - eat shit and die (effect murder), weezer - keep fishin, like light to the flies(demo) (trivium). muse (mike oldfield) - knowing me, knowing you (tad morose) - in nomine satanas (paradise lost), black metal (killers), i got a right (iggy and the stooges), fill your head with rock / kim mitchell, god of thunder (buzz osborne) - true life (lights of euphoria) - transylvanian concubine [the marilyn manson mix] (rasputina), love like blood / pale sky - roy orbison - i can't stop loving you. whiplash (billy milano/scott ian/phil soussan/vinny appice), nekrophilie (misantrophe), naio ssaion - the mirror. eversleeping (xandria), declaration of freedom - desire. welcome to hell (anathema), noel gallagher - don't look back in anger, burning in hell [possessed cover] (angel corpse). vampires will never hurt you (my chemical romance) - apple shampoo. betrayer (wizard), back to the roots (human nature) - viking skull - born in hell - die dead enough (megadeth), the forsaken (adumus). astro zombies (pennywise). the thing that should not be [metallica cover] (carbon12), fly (misanthropic). hidden inteligence (green manalishi) - the rock show (blink 182). living in fear (pazuzu). dracula rising (two witches), burden (mindrot - edit version). inme - 7 weeks - k.haos-prinz und wind-prinzessin (samsas traum). i want you (kip winger) - spill the blood, threat signal / when all is said and done (demo) (various), the enemy, seek and destroy (birmingham), the root of all evil (criminal), les fleurs du mal (in meditarium). sailor's tragedy (the beautiful desease), analogies of appearances (datura). khali ma (vampire moose), soporific anabiosis (mental demise), gouge away (promise ring), cannibal corpse - hammer smashed face, totentanz (corvus corax). cell division - skin fetish. geoff downes / the endless enigma (trent gardner) - close to decomposing. state of mind (manitou). version 2.0 (staring back), zombie ritual (profanity), something corporate - straw dog, ride the sky (helloween), the last candle (dead poets society) - agnostic front / peace (live) (various) - a little bit of what you fency (runamok), brand new demon (brand new demon) - alison hell (annihilator). sonata arctica - die with your boots on - fire and blood (edit) (wizard), requiem (boysetsfire), you look like rain (morphine). schwarz schaut tiefsten lichte - with you (dark one) - crosstown traffic. last days of the humanity - l.d.o.h. - han som reiste (burzum). slipknot - the nameless (live). mourning palace (dimmu borgir), post mortem (seance) - deadlock - earth, revolt. we will rock you [queen cover] (warrant), when the children cry (white lion), the last in line (destiny's end) - nachtwraak - a lost forgotten sad spirit, sister golden hair (america), scream bloody gore (adumus). coldplay - don't panic - sympathy of the devil (tiamat) - agent steel - demon's night, the shooting star that destroyed us. into the void (monster magnet), dreptu allur (vondur). verbrannte welt (inscape) - the fire burns (valley's eve). spawn (revenant) - armageddon (the abyss), heavy metal thunder (dark age), stereophonics - handbags and gladrags, savoy brown boogie (savoy brown). peace sells (habeas corpus). dreams and bridges (aereogramme) - house of the rising sun (london symphonic orchestra). abscess - suicide fuck, damn my soul (unterart) - yes - owner of a lonely heart - parasite (span), snoop dogg / fool'n yaself - back in the saddle (lou gramm with sugaar blue) - we.re all alone (rita coolidge). the who - we're not gonna take it (from "tommy"), l'ame immortelle - another day, heaven (warrant), discover me like emptiness (in flames), theme for a jackal (capitao fantasma) - stand by your man (lemmy with wendy o williams). complete heat (fight paris), breathe from coma (hopesfall) - reach the uncontrolled (corporal raid) - disarm (national product), bad luck (funny money), roots (the capaces), allegedy, dancefloor tragedy (suspiria) - mannequin (cradle of filth), star rats (sweden): "long live rock'n'roll" (rainbow), bonnie tyler - total eclipse of the heart - mercy (orphaned land), indians (live) (anthrax). lick it up (kiss) - la canzone di solving (nino rosso), rod stewart - tonights the night (gonna be allright). hold the lines - sailing (the shadows). sadistic bitch (necrocannibal) - symphony of destruction (fury). banquet (bloc party). circle of tyrants (celtic frost) (opeth). banner of blasphemy (agathodaimon) - waves (take me alive) [#] (rhea's obsession) - 20000 feet (paragon) - temple (the shadow dance) - war pigs (live) (faith no more), the cross we bare (axenstar). last child (cathy richardson with wayne baker brooks). bela lugosi's dead - in joy and sorrow (him), friend of the night (mogwai) - who wants to live forever - breaking benjamin - fatue (tanzwut). gigantic (reel big fish), the forest whispers my name (willow wisp), horror hotel (easyway), death on two legs - rooney - the gathering - amity (live). dope - no chance (mr.mcmahon's theme) - come out and play. starlight (grave digger), guns n roses - oh my god. play (bleak). eisgang. running with the devil - truest flame (age of ruin). the freezing moon (mayhem). necropolis (the absence), i don't know (jack blades / reb beach / jeff pilson). out opf breath (the old dead tree). john b. sebastian - rainbows all over your blues. sleeping in the fire [w.a.s.p. cover] (tiamat), tourniquet (bile). it's a long way to the top - crucified (mvp), the calling - wherever you will go, nine inch nails - seek and destroy. sister of charity (69eyes). halloween [king diamond cover] (mortuary oath), sweetest poison (nu pagadi) - you cant handle (live), black sabbath - paranoid - for the punx (the casualties) - embryoyo (rompeprop), eveline (rockbitch) - bomber (motorhead), motorbreath (live) (rage) - dimmu borgir / broderskapets ring (various). don't know what you got till it's gone (cinderella) - wheels of confusion (cathedral) - the diamond ring (adair) - bulls on parade, largartija nick - shoot it in (the duskfall) - i'm tank!. leaves scar (amorphis). make your own (clinger) - id.feeling (mass motion) (architect), waldgang & apolitea (von thronstahl), staind -outside - staind -outside, redemption (invictus). the skids - into the valley, exit signs (autopilot off), nervous breakdown (the bled). the ultimate sin (soulless). giving in (a thousand falling skies). future world [helloween cover] (labyrinth). circle of light (knightmare) - my dying bride / for you. if i could only win your love (emmylou harris), cypress hill - just another victim (tazz's theme) - mac davis - in the ghetto. back to back (pretty maids cover) (hammerfall), the everlasting gaze (the stiletto formal). with a smile (agoraphobia) - birdo (horse the band). breathe (in the air). ulvaskull (vargr) (grand magus) - whiplash (destruction), fire on the mountain (marshall tucker band), the one (tommy henriksen). hallowed be thy name (iced earth). seelenschmer (blutengel) - die computer verlassen die wel (welle erdball) - live wire - scar tissue [exclusive] (adam christian), smile in your step (silverstein) - to hell and back again (breaker). work for love (en esch). einsamkeit (eclipse edit) (sero.overdose). hurtlocker - absoulution, shout it out loud (kilmeister, lemmy). metal heart (accept) - rise and fall (criminal) - spanishfaster (ringside), lord of this world (brutal truth), is this love (whitesnake), wounds (hollow) - elton john - dont let the sun go down on me, power and will (part i) (mgla), nokturn (profundis). quarite lux in tenebris (rossomahaar). take a look around (limp bizkit). (get a) grip (on yourself) (the stranglers) - gilded cunt (cradle of filth). rockin' all over the world (status quo). rock is dead (cvr mix) (luxt), deconstruction (all shall perish) - r.e.m. - losing my religion, no fear (rage) - igor khoroshev / the barbarian (robert berry). falling (machine men) - the clash - white riot - so grim so true so real (one man army and undead quartet), matchbox (lemmy / slim jim / danny b). ventilator blues (clarence "gatemouth" brown & larry mccray). faustrecht (feindflug) - responsibility (mxpx) - restless and wild (pegazus). this is the last time (keane) - i could care less (devildriver). cold wind. girls, girls, girls (motley crue), die stille (law of the dawn) - in my eyes (since the flood). led clones (domain) - coalesce - blue collar lullaby - garbage - cherry lips. jorn lande - enlighten me, don't know what you got (till it's gone) (cinderella), anytime anywhere (gotthard), wind of change (scorpions) - apoptygma berzerk - nothing else matters, sad but true (joey belladonna/bruce kulick/marco mendoza/eric singer). man over board (blink 182). so pure to me (agnostic front) - you got me running [def leppard cover] (kory clark). bats!!! (the bronx). they are building walls around us (moneybrother), zwischen zeitrausch und leben (perfidious words) - pull harder on the strings of (trivium). bad bad boy (steve grimmett (grim reaper)). the truth takes me... (forbidden colours) - interstellar overdrive (liquid visions). total death (krisiun), strange world (mago de oz). unleash the beast (airborn) - goddess (the merry thoughts), contrast of light and dark (yesterday's rising). let there be rock (paul shortino / craig goloy / tony franklin) - i am hollywood (he is legend), marvin gaye-diana ross - pledging my love, fade to black (exclusive track) (sonata arctica), crionics (merciless), chasm climber (deivos). dancing into the apocalyptic sun (despairation), fear (disturbed). in god we trust (stryper cover) (thy majestie), maifeuer, tsunami (effect murder). egypt (the chains are on) [doro], ektomorf / son of the fire (various), 4 words (to choke upon) (bullet for my valentine) - the antlers of the midnight sun (comets on fire). river runs red (life of agony), durch nacht und flucht (lacrimosa). hold the line (toto) - the weeping song (nick cave). freedom (busdrivers), the hordes of nebulah (performed by darkthrone), confessions [possessed cover] (cannibal corpse) - amber girl (lacrimas profundere) - knock em' dead, kid (b-movie rats). kiss - do you remember rock and roll radio?, nothing between us (until the end) - am i evil (diamond head) - in the shadows (the rasmus), dreams of sanity - the creatur. i don't wanna be (a superhero) - kick some ass (stroke 9) - wreath of barbs (album mix) (wumpscut). the ruts - babylon's burning, prime evil [venom cover] (skyclad) - love song (tesla), spill the blood (grope). judgement day, separate (sevendust), blind suffering (brainstorm). rock&roll lady (lisa dominique) - london dungeon (prong) - overcast (imperative reaction) - ram jam - black betty, burning inside [ministry cover] (static-x) - killing yourself to live (anal cunt) - das meer (diorama) - intro (mixomatosis) - metropolis part i (overlife), everything is everything, raise the dead (unanimated) - a threnody for modern romance (live) - john wetton / bitches crystal (trent gardner). killed by death (motorhead). venom and hope (the banner). goo goo dolls - here is gone. in flames / only for the weak. suzanne vega - luka, wake up and die (a perfect murder), easier to run (dark one) - avolo (das zeichen) - ever and a day (diamonds & lust) - cardinal sin (amber asylum), to tame a land (morgion). transylvania twist (ex-voto). switchblade (mad dogs n glory) - take this life (in flames), trapped under ice [metallica cover] (impious) - 1979 (lao). i want out (sonata arctica), eddie vedder zeke - i believe in miracles - how i couldt just kill a man (rage against the machine), redlight zone (gladiators) - when you're in (tiamat), wrathchild (stuck mojo feat. devin townsend), mesmerism (faith and the muse) - s.a.t.o. (deceased) - ille trane (traumtanz). ad astra - adastra (arcturus), run like hell - opened (glis mix) (assemblage 23) - sound of silence (atrocity), nice / dr. love - south texas deathride (union underground). white line offside (machinegun kelly). valkeuden hauras tuhka (musta surma), europe / scream of anger - dead in hollywood (murderdolls). let the world burn (until the end) - i don't need your kind (rockin' vickers). where did we go wrong (magna fi). holy moses - disorder of the order, paul mauriat - alla figaro. inhuman desires (perdition) - wildfire (sonata artica). creed - young grow old. airwave raid (lower class brat) - heinous kingdom (vittrah) - get down and dirty (wheels of steel), mother north (performed by satyricon) - last one for the money (nora), generation clash (tarot) - dillinger escape plan - 43% burnt, dead or undead (the growling stones), napalm death - dementia access, size (betty blowwtorch feat. vanilla ice), egypt (the chains are on) (doro), neon knights (steel prophet). love of a lifetime (firehouse). (hed)p.e. - (hed) p.e. - swan dive - billy swan - dont be cruel - fools never die (nocturnal rites) - dividingline / burning sky - kid rock - legs (stacy kiebler's theme), craig chaquico / sacred ground. multiple jj (reveral penetration) - nights on fire (torino), hass (merlons). golden brown (the stranglers) - horror business (deadguy) - betrayer (wishmaster) - the momnet of our love (negative). ewige nacht. 3 inches of blood / ride dark horse ride, justice, fast as a shark (steel prophet). jagger '67 (infadels) - temple of love (sisters of mercy). medusa and hemlock (cradle of filth). forever (throwdown), i believe in a thing called love (the darkness). so alive (ryan adams). breaking away (avantasia), forgotten (razed in black version). desecration of souls (armageddon) - fire in the sky, midtown - knew it all along. falling away from me (korn), industry (the day everything became nothing) - organised crime (u.k. subs). guerre oppose aux immegres (opfer rassenhass) - prey to the lord (deathwish). rasputin (metalium), glassjaw - cosmopolitan blood loss, metamorphosis ((in) ternal) - accelerated existence (corporal raid). she's a killer, under jolly roger (running wild) (therion), lullacry - alright tonight, silver machine (hawkwind), fausto papetti - concerto nr.2. fight for your life (the casualties), enjoy the silence '04 (depeche mode), wuthering heights [kate bush cover] (angra), kleiner engel flugellos (mantus), the load out-stay (jackson browne) - katrina & the waves - walking on sunshine - belphegor (barbara rossa). who are you (old), the end (wanhoop), vet for the insane (fields of the nephilim). enfected - dreams. bad company / bad company. highway star (deep purple). another face (terror). obtuse (soul demise) - take their lives [kreator cover] (the chasm) - chainbreaker (primal fear) - fed up - the truth hurts, empty words (fuck the facts), children of the damned (therion) - iron maiden (tankard). losing more than you ever had [accept cover] (tad morose). in darkness ruin and death (strandhogg) - nickelback - too bad - never again (nickelblack). tired n' lonely, richie havens - freedom, tie your mother down - shinedown - cornucopia (vicente salerno). gewaltberechtigt_ (goethes erben). hollow heart (to die for), ravnajuv (performed by darkthrone), demonologic (homo twist). behind blue eyes (limp bizkit). davidian-machine head-davidian (machine head) - damage inc. (razed in black), endless (unearth) - simple blue (demo version), wherever i may roam (godheads) - just let me rot (pungent stench). o fortuna (therion), n.i.b. (pitch shifter) - numb (hourcast), make them suffer (cannibal corpse), surrender (midnight blue) - so grim, so true, so real (one man army & the undead quartet), born for burning (satyricon). dismembered (dismember) - vote for love (tiamat). remember (love like blood). shame on the night [solitude returnus] - die zeit des lichts (pilori). sexy telephone (smelly boggs) - what a day (nonpoint) - strike (combichrist) - cheap sunglasses - ghouls to strike (desaster) - freiheit ? (kontrast feat. ivi) - it doesn't happen to me every day, can we talk a while?, soundtrack
celestial seasonyear of our lordcallenish circlesammet tobiaswashington dinahdead elizabethorange 9mmcaravanpalmer robertbilly idoltrioswords of scornkotipeltoneon rosedown to earth approachilonatimeless miraclesepulturaclinicprongasher jamesozric tentaclessevag oysteinwestlifeshameladytrepaliummanilla roaddystopiachaostarbannerwarbozzio levin stevensswingle singerssoundtracks gamestad morosecataractdarkest hate warfrontyobdrawn and quarteredkarnivooldecemberzwanconducting from the gravelove spirals downwardseternal aumerce joseadramelchtriviumfates prophecyvollenweider andreasin ruinssinnedarmageddahavayothdarksunmy ruinsymphony in perilmcferrin bobby
the keepers of jericho: a tribute to helloween
. slut (l'ame immortelle), i hate you (the exploited), stand my ground (single version) (within temptation), restless and wild [accept cover] (pegazus) - voodoo child (slight return). i want to conquer the world (astream). turning over (morning again). crionics, darklands (paths of progression) - open hand - time to talk, firedance (die laughing). first there was rock (panther), willst du (untoten vs. soko friedhof), showdown (shattered real) - ultra violence (lower class brat). kleid aus rosen - saint-preux - concerto pour une voix, we live (electric wizard). girls not grey (the grave matters), countess bathory (candlemass) - guardians (rhapsody) - unreleased outro (mortiis). halt mich (lacrimosa), 10 cc - wall street shuffke - eye of the beholder (in flames). paper law (hostile breed) - shackled to the trilithon of kutulu (bal sagoth), pyogenesis / blue smiley's plan - summer's end (amorphis) - you that mingle may (performed by thorns). high voltage (razed in black version), execution style (soulfly) - the illusionist (scar symmetry) - strong arm of the law (heavy metal maniacs), balls to the wall (sinner) - whatever that hurts (tiamat) - kids in the way - we are. alien ant farm - attitude, how you remind me (nickelblack) - lord of earth and heavens heir (human fortress), seal - crazy - lorded gun (dionysus) - meaning in tragedy (as i lay dying), luna (novena). is this love (clap your hands say yeah) - the ballad of jayne (l.a. guns), palmer / who am i - land of the free (sonata arctica), vedj meg lang 1 (echo of dalriada), jordan rudess / hoedown (robert berry). uh! all night (diabla) - (don't fear) the reaper, novembre - cloudbusting (kate bush cover version) (feat. ann-mari edvardsen) - scented - turn to ash (dew), the prophed (gary moore). ride on - viking skull - born in hell. hollow (sun caged), mister superstar (alex xenophon) - for the record (stretch arm strong) - a past and a future secret (salamandra), looking for love. the oath (withering surface). a lesson learned (ludovico) - ready steady go (generation x) - sheryl crow - run, baby, run, ich will dich. dark entries - last molest (entrails putrefaction), trows kind (elvenking), spectator to love (shouting myke) - funeral forest - gebrechligkeit ii - shark ethic (my precious blood) - cymbaline, dont stay (dark one). welcome to hell (anathema) - the undertones - teenage kicks, save me (supreme majesty), fallen rage (misery inc.). grade - gathering darkness, price to play (staind) - gary moore & phil lynott - out in the fields - der rose auge gluht (endraum). nicolas de angelis - eine kleine nachtmusic - whole lot a rosie - funanbulo (fa de sabio). grinder (kreator) - fight it back (sacred steel) - mr tambourine man (the byrds) - the members - sound of the suburbs. chad kroeger ft josey scott - hero, gimme! gimme! gimme! (a man after midnight) (abba) (sinergy) - the message keeper (empty tremor), heliopolis (shining vril). ein duell mit gott (samsas traum). love bites (nevermore) - wollt ihr das bett in flammen sehen [rammstein cover] (battery). one of use (flowing tears) - run to the hills (steve overland). steamrock fever - phil lewis. very invisible (armor for sleep), structure, cradle of filth / satyrisis. cum on feel the noize (slade). once upon a time in america (ennio morricone), cut throat (gardenian) - stern & rampai - concerto in g-minor allegro - story of the year / the heart of polka is still beating. kim mitchell-fill your head with rock (kim mitchell). nerdolokaust, overflow (razed in black) - if i could collapse the masses (trivium). liebe (remix) (d.-pressiv), world's so cold (mudvayne), cherokee (europe) - island in the sun (weezer), i let go (eighteen visions), cannibalistic fantasies combined with sadomasochistic practices, ei toivottu vieras (intro)/tyrannia martyrum (exordium) - spurlos (letzte instanz), me my enemy (thunderstone). enter the eternal fire (necrophobic). solitude (cathedral) - vigilante (magnum). overnight sensation (live version) / motorhead. intercranial brain damage (gored face) - nickelback - too bad, fuck the u.s.a [exploited cover] (destruction) - summersky (mondragon), kleiner engel, time is on my side - the pretenders - something to believe in. bloodsucker, staple - pop - weg zu mi (blutengel), under the sky (compact mix) (interlace), rejection role (soilwork) - fiction (orgy), concilium (remastered) (oratory) - heart of steel [manowar cover] (hourglass). puls des lebens (jo mix) (endanger) - love lost in a hail of gunfire (bleeding through), ruin (lamb of god). durch die nacht (single mix) (silbermond). for what it.s worth (buffalo springfield), down here, we all float. supernaut (1000 homo djs), phil collins - in the air tonight, painful relief (interior). ghouls night out (simbiose) - she's got issues, olaf senkbeil - dream real. komm zu mir (unheilig) - in all honesty (paradise lost). wasted time (edguy) - zeitbombe (girls under glas). this flight tonight (doogie white (rainbow)), i disappear - anti-government, revelations (live) (therion). third degree burnout (daredevil). the phantom of the opera (nightwish). aerie descends (thorns). heroes (masterplan) - solefald / survival of the outlaw - this mirage (christian death) - dead before i stray (into the moat), burn it down (sencirow), silent scream. alec eiffel ( the get-up kids). stick to our guns (little rebel) - mellom bakkar og berg (performed by storm). 4 walls black (genitorturers), jefferson airplane - volunteers. candi staton - suspicious minds. stand and fight (code 415). edguy / wasted time - bedroom talk (the starting line) - worship manifesto (anorexia nervosa). falkenbach - skirnir, bazz (maelstorm inc), there must be war - imperial vipers - kick a hole - so tired. awake and lifeless (live), power - no lust for life (barcode). ava adore (nodes of ranvier) - set the controls for the heart of the sun (mindala). damned in black (immortal). you are my family (doro), blue bayou (linda ronstadt), linkin park - in the end, living after midnight (judas priest) - prime evil (skyclad) - maybe (remain the same). clouds connected (in flames). raze (exodus). jesus built my hot rod (shining) - i am a viking / yngwie malmsteen, arlo guthrie - coming into los angeles. exhalted in depravity (hecate enthroned). night of fullmoon (sacrificia mortuorum). strommoussheld - era depression. ella me ha dejado (jacky trap). resume ignore (exit ten). secrets of life (platitude) - 5.7.0.5 - the night of the ages (dark moor). rock'n roll stormtroopers - i'm a rebel. deteriorot - read between the lies. tony martin - wind of change - fainted eyes [celtic frost cover] (ragnarok) - no one like you - jizzy pearl - ...og jeg iakttok dodsriket (old man's child) - london dungeon ((f.e.v.e.r.)), rsj - dystonia - i stole your love (robin mcauley) - ich bin nicht von dieser welt (welle erdball), kindertotenlied (untoten), sabulum (pharus) - nickelback - how you remind me. carnal forge [carcass cover] (aborted), seek'n'strike (soulfly) - reality check (the legacy), du riechst so gut (rammstein) - ideologie (seelenfeuer) - tears for eternal monuments (tenebrarvm). vulva rasgada. fade to black - miscreant, more than a feeling (boston), pleiadian agenda (hanzel und gretyl) - prowler in th shower (xxx maniak). shae seger - clutch, helsinki (waltari) - vile extremes (negative format). jeff scott soto - i want to take you heigher - tear away (drowning pool) - time what is time (the arrow), king of the world (tigertailz). heavenhell (madball), metal church [metal church cover] (powergod). cry st (cortege), aska (usa): "flight of icarus" (iron maiden) - a fortune in lies (evil wings) - manipulate my mind (demisor) - der totentanz (mondsucht). shot in the dark (soto, jeff scott / bruce kulick / pat torpey), tie your mother down (lemmy). pagan love song, i woke up in a car (something corporate) - moonchild [iron maiden cover] (stormlord), salvation (caliban), so fukkin' sikk (undercover slut) - american woman cd2 (guess who), blood brothers (papa roach), saturnus / noir - into the rage (amplifire) - c.d.m., points of authority (dj chiller vs big ed), ion storm (performed by dodheimsgard), now the world (gothacalypse) - madder mortem - faceless, adapted fools (castaway). tormentor (fleshfeast). pedro alvarez - la traviata - annie lennox - here comes the rain again. house of sleep (amorphis) - the ghost of tragedy (day of contempt), bryan adams - im ready, deceiver of fools (within temptation). hit the floor (dark one). paranoid (black sabbath). djanga (mila mar). rastaman-dita (molotov). meat loaf - dead ringer for love, hure (die schinder), i'm the one, dead embryonic cells (sepultura). wilder wein (rammstein), fat bottomed girls - antigone rising - master of puppets - dr. know - ein kleiner schritt (sportfreunde stiller). spread your wings (queen) (blind guardian), oh my goth! (razed in black) - kein ton (black heaven) - of beauty's embrace (night in gales), kim (pierrepoint), him - poison heart, nightfear (benediction) - rapid fire (testament) - realize (shameless), motorhead - ace of spades, bullet (the no counts d.o.m.) - paranoid (vince neil / george lynch / stuart hamm), enter sandman (lemmy). limited normality (corporal raid), pool knight (the amphetamine), dead red roses (left alone) - welcome to the machine. liquifield flesh into red mush (gored face) - april wine / sign of the gypsy queen - zeit zu leben (extended version) (wave in head), kaihola (kotiteollisuus) - the rich man, echo (jimmy crespo/dave ragsdale) - dead by dawn, belt (say anything), the chance - die liebe (atrocity feat / das ich - remastered) - barbarism returns (nacht und nebel). bonesplicer - original prankster (offspring). necromancer (deathwitch) - forever (shattered) failure (misanthrope), 237 (fear before the march of flames). far between nowhere (eight fingers down), staring at the sun. 1916 (motorhead). valentine (white rose transmission). breeding the insanity (demisor), skindred - nobody, jemand (out of norm feat. n. l. endris), leben (calva y nada) - the hunter (iced earth). place for my head (gothacoustic ensemble), sevendust - break the walls down (chris jericho's theme) - heaven and hell (enola gay) - my girlfriend's girlfriend (type o negative) - crosby, stills, nash & young - wooden ships, ever-frost (sentenced), under the sun (soulfly). megalodon (live) (mastodon) - kiss of the cobra king (powerwolf) - abgesang (stendal blast) - nachtwache (kiew) - the warning (arachnes). the wormz of sephiroth (bahimiron). evermore - sun doesn't rise (mushroomhead), comfortably numb (eternity x), the thing that should not be - flegma, hold me down (tommy lee) - black hearts now reign - shaunluu (norma jean) - breaker - breaker. nuclear waste bring that shit (we want a state of radiated superheroes) (curl up and die). train (enginedriver and crazy guard) (pigsty), ray conniff - my serenade. city boy - 5.7.0.5. - teenage mustache (locust, the), i am the black wizard (emperor) - great fury (inside) (chainsaw), the kids are back (dee snider's smf) - marshall tucker band / fire on the mountain. hey stoopid (alice cooper), revelation (nocturnal rites). a dangerous meeting [mercyful fate cover] (wolf), camel song (korn). murder by decibels (warchylde). maschine zeit (funker vogt), new disaster (i am the avalanche), desert song - traumtanzer (diary of dreams). going to brazil (green dollar colour) - eric clapton - layla - behind blue eyes [the who cover] (limp bizkit), ancient blood (bannerwar), 747 strangers in the night (saxon). leiche zur see (ewigheim), in motion (the gathering), inner self (impious), over the top (young and moody band), ghouls to strike (desaster), mr. crowley (ozzy osbourne) (moonspell). after forever (aurora borealis). flesh grinders (squash bowels). sky - masquarade - carnival of fate (black destiny). dead skin mask [slayer cover] (unanimated) - despair-ridden hearts (sentenced), the pretenders - brass in pocket, motorhead (motorhead) - shot down in flames, battery (high voltage mix) (la honda militia), gimme all your lovin', everyday sunday - mess with your mind. hard luck woman (ron young / jeff watson), zero the hero (cannibal corpse), black jesus (everlast), sparta - mye, demonstrating my style (madball). gone (northern lite), no dreams breed in breathless sleep (dissection). manic depression - crystal ball (crystal ball), rainbow eyes (catch the rainbow). blood pigs (otep) - sweetness (jimmy eat world) - over the mountain (mark slaughter / brad gillis / gary moon) - hexagram (deftones), die wirklichkeit (zeraphine). event horizon (desdemona) - this lying world. the book of leviathan (the black). witching hour (kreator) - wasting away (nailbomb) - all guns blazing (xiron), baptized in semen and steel (xxx maniak) - hybrid moments (octopus in the fishmans style). do the dog (the specials), shadows from the past (narnia) - raise hell - slaves to metal - instruction / breakdown - born for burning (originally by bathory) (performed by satyricon). captor of sin. extreme ways (moby), amie (pure prairie league) - coma america (amen), headed for a heartbreak (winger), dazed and confused - leave me here (cult of luna). now you know (full devil jacket). herod / lies and betreyal, assassin soul (suspiria) - dr. stein, nazareth / hair of the dog - destroy all (static-x), when everything falls (haste the day) - tad morose - losing more than you've ever had. suicide (the wake), facing hell (ozzy osbourne). ride of the valkyries (delpht). france debout (nocturne presents). death row (crazy lixx), testify to me (virus) - the jeweller (this mortal coil) - ian dury & the blockheads - sex and drugs and rock 'n' roll. fields of gold (sting). torturous (nosferatu), 2hell (ladykiller mixx) (dunkelwerk). last resort (papa roach), hymn to lucifer (daemonarch) - tom robinson band - 2-4-6-8, fade to black (live) [metallica cover] (disturbed). learning to live (eleventh hour), dreaming (morbid angel), trinity / take away the anger - red rain / red rain - mr.crowley - deadly sinners (3 inches of blood). may the sunshine (steve overland (fm)), screaming for a lovebite [accept cover] (rough silk). gary hughes - dragon island cathedral, necropolis (the absence) - the final waltz (running wild). the reason (hoobastank) - the wanderer (emperor) - jj cale - cocaine. satanic obsession. massacre (lord belial). silence is deafening (napalm death), staind - outside, angelfuck (dead combo). signs of danger (burning point). naar himmelen klarner (burzum). in flames / artifacts of the black rain, trip in the fire (the zoes feat. kiko), firewalking (moonspell). the hellion/electric eye (helloween) - germ of error (cerebral turbulency) - rufio - over it - dr feelgood - she does it right, parricide - behind the scenes. fortune present gifts not according to the book, send me an angel [scorpions cover] (custard), jesus gonna make my dyin bed (3 stages of pain), the fire snakes (vortice). lost (beautyful sin) - the sun never shine on tv (the gallery). morbid angel - dominate - into the void (exhorder), wheels of steel (v8 wankers), march of time - land of the dead (summoning). to be gone (anna ternheim), dead by dawn (deicide), triumphant devastation (deathwitch) - forever (eternity mix). on the road (live) (motorhead), you can't always get what you want (luther allison), a tale that wasn't right, score (allegory) - birth (gravedance), thrusted to the limit of all delights, war diary, perry mason - taking back sunday - cute with. from autumn to ashes - jack and ginger, bob catley - gonna live forever, crippled & broken (kataklysm) - the angel song (great white) - guano apes - open your eyes. reach and touch (american head charge), get your gunn (get your hallucinogens mix) (nocturne). sin city [ac/dc cover] (everclear). hole in the sky (coffin break). nothing's wrong? (devildriver), disbelief - stranger in a strange land. chains of humanity (god forbid). wotan wears in winter (harvest rain). arise (crown) - flesh parade - monsiur lebeaux - godgory - princess of the dawn - the ballad of jayne (l.a. guns) - symptom of the universe (sepultura). flight of icarus - ripper owens - seelenschmerz. wir sind nicht allein (welle erdball). so sad to say (the mighty mighty bosstones) - leuchtfeuer (nachtschwarmer mix) (illuminate), alice cooper / no more mr. nice guy. max greger - gaschichten aus dem wiener wald - carly, girls got rhythm (robin mcauley / bruce kulick / tony franklin) - storm of the beast (mystifier) - young lust - revealment of the cosmic harmony (darkthule). kill the king (stratovarius) - i'll see you in my dreams (giant). rock'n'roll woman (robbers dog). on with the show (doorslammer), power and will (part iii) (mgla). science fiction (xtc), we bury our dead at dawn (the agony scene) - fight fire with fire - luciferion - wait (white lion) - killers (destruction), wings of a butterfly (him), declan (jeff back), black sabbath (acheron). the labyrinth of despair (heuresis). train kept a rollin' (david 'homeboy' edwards) - promise (spoken) - feathers fell (dissection), lugner (tanzwut) - the final countdown, deathcar racer (president evil) - the only truth (heaven shall burn) - a fine day to die (emperor) - man to fall (gorefest), du som hater gud (satyricon). holy man (venom), ginnungagao (therion). opium (moonspell) - caravans to empire algol (performed by neptune towers), damage limitation - skeleton toucher (xxx maniak), executive control (code 415). year of the boomerang (jenny barry). back from the days (machine men) - behind the faith (clandestine blaze) - essence of brutality (domination through impurity) - static-z - cold - falling in love - marq torien, forever autumn (lake of tears), nuns have no fun (deceased) - the outlaws / green grass and high tides. coincidence (exilia). x ray spex - oh bondage up yours!, burn (deep purple) (soilwork). all hell breaks loose (we were wolves). genetic deformations (incarnated). between angels and insects (papa roach). joan baez - joe hill, holes - fly high michelle (enuff z' nuff), fear of the dark (graveworm) - mortician - fleshripper - the arcane (trail of tears). from the shadows (tarot). follow (disbelief), still waiting (angina pectoris) - sting - every breath you take - thunderstone - diamonds and rust. running free (iron maiden) (grave digger), arch enemy - nemesis. live - overcome - slowly mutating (implant). the cruise / antichrist (sacramentum) - troups of doom (dimension zero), opeth - remember tomorrow, constitution down. towards damnations end (satanic slaughter). i am the fly (wire) - portrait of the dead countess (cradle of filth), eternal torment for myself (bredor) - curse of god (the ransack). trivium / if i could collapse the masses, broken down angel (paul d'ianno (iron maiden)) - tnt [ac/dc cover] (sister machine gun) - up from the ashes (edit) (gothic knights), in league with satan (voivod) - i didn't know just what to do, i couldn't seem to take my eyes off you, 2003
2001
. dying songs (incarnated) - muscle museum (muse). let it be broke (weeb) - against the wind (stratovarius), kamelot / march of mephisto - regenerated (biomechanical). face of destruction / deep hit of death (the crown) - burn (hanin elias). primal fear / evil spell - u.d.o. - xtc, drool (mother) (switchblade symphony) - stefan nicolai - la boheme. good times bad times - live - lightning crashes - the thing that should not be [metallica cover] (razed in black) - the night they drove old dixie (the band) - whiplash (abaddon of venom), the eyes of the amaryllis (the escape), john cougar mellencamp - jailhouse rock, anthem part 2. holding on - mountain music (alabama), no donny these men are nihilist (evergreen terrace), remains-white walls (still), destroyer of senses (shadows fall), unchained (5150), saturday night (pretty boy floyd). london leatherboys (rykers), shunk anansie - all i want. nail in the coffin (artillery hell), fast as a shark (accept cover) (helloween) - more than words (extreme) - away (crematory), the flame (cheap trick) - between heaven and hell (firewind) - yngwie malmasteen - crying - over the mountain. dark tranquillity - 22 acacia avenue, theatre of pain (syrius). runaway (gothacoustic ensemble). han on pimeys (musta surma), rosemary's son ft ilse delange - shine, have a cigar - eagle (sargant fury) - set your madness free (bright ophidia), get it on (t.rex). the end is here (live) (alter bridge) - end of time (jorn) - flieg mit mir (crematory). room of our existence (velvetcut). welcome home (sanitarium) (whitefield crane/john marshall/scott ian/tony levin/mickey dee) - paradise (lemmy & the upsetters with mic), storm of the blades (battlelore). the union underground - across the nation (raw theme), take hold of the flame [queensryche cover] (ion vein), starlight. crosby, stills, nash & young - sea of madness, livin it up (verbal graff), sheryl crow - strong enough - limp bizkit - crushed. mobon / fight, primal fear - seven seals - goth' music (umbra et imago) - saviour (pure inc.) - hollywood girls (the resistance) - the hives - hate to say i told you so, dimmu borgir / a succubus in rapture. post mortem, enemy of the state. no shelter (symphorce), 7 - tim skold gotta die (drone 24). alsvartr (the oath) (emperor), hell awaits - naio ssaion - the mirror. sounds from the street (the jam) - billy idol - rebel yell, vlike a child again (the mission). heaven and hell [enola gay]. hit the lights - sloppy seconds - avatar (ephemeral sun) - power [helloween cover] (highlord), the eight of callousness (spineshank), nightwish - beauty and the beast - bullet in the head (scarecrow adams), inseminate or die (inseminator). the gates to the kingdom of darkness (sombre chemin) - nazareth - razamanaz. monsters (matchbook romance) - verdoemenis (lemuria), requiem for an evil (apokatastasis). augen auf (oomph!), high hopes, emerson, lake and palmer - romeo and juliet, a dream resigned (daylight dies) - best friend money can buy (tiamat), enigma of the absolute - don't talk to strangers [blind guardian], meridian (sirenia), no education (apocolyptica), shadows fall / what drives the weak - she don't love me (edit) (noyce tm), buttsuck - p.o.d. - boom, the eyes of the world (freedom call). battle hymn (manowar) - bjork - human behaviour, i need you tonight. bad hangover (crucified barbara). do tagte ez (helium vola) - you're in urine (screaming afterbirth) - yankee ros (enuff znuff), time out, floorshow [the sister of mercy cover] (headtrip inc.) - visions of sorrow (zonata), damn my soul (save my soul rem (unterart) - gorgar. land of confusion (genesis) (in flames). wherever i may roam (exclusive track) (sinner). no speech (guano apes) - bow wow wow - c30 c60 c90 go, crowded house - four seasons in one day, was halt mich noch hier (l'ame immortelle), take me to tokyo (vanity beach). was haelt uns wach (wunder) - r.a.m.o.n.e.s. (motorhead). rsj - dystonia. leviathan (akercocke), utopic unknown being (corporal raid) - kane - let it be, call from the grave (dark funeral). are you there (anathema). highway child - outside (dreadful shadows). john west - when worlds collide - dragon reborn (edit) (black majesty), under my thumb (lucky peterson). the midas touch (the quest part iii) (cryonic temple) - cherry pie (warrant). die goldene kette (schandmaul). the black league / deep waters - earth a.d. (earth crisis). premutos (tumor). the sound of silence (simon & garfunkel) (nevermore). shores of madness (iconoclasm). christian woman (type o negative). slow an easy, post endotraumatic facial disorder (gored face) - still screaming (self destruct) - antichrist (club mix) (the retrosic). eat you alive [limp bizkit cover] (necessary evil). tush (zz top), wasting the dawn (the 69 eyes) - pagan fears (mayhem), surfing with the alien (jake e lee). deception, gates of babylon (yngwie j. malmsteen), love theme from flash dance (georgio moroder). deuce (marty friedman) - here to stay (korn). flowing tears - razorbliss, dark (illdisposed), dark wave mix part ii cd 2 - ridai zhid-apostol, champing at the bit (every time i die). turn (hexedene) - 2-4-6-8 motorway (tom robinson band). wake the dead (comeback kid). first date, rival schools - used for glue - war of the worlds (rage) - warpath (domain) - slide it in (whitesnake), (i can't get no) satisfaction (junior wells). stereomud - end of everything (raven's theme) - more human than human (live) (rob zombie), sylvain sylvain (the beauty school drop-outs) - wasted years (thunderstone), honestly (stryper) - gold dust vs state of illinois (spitalfield). shed your skin (love like blood), eye for an eye (virtuocity). cthulhu dawn (chronzon). boogey man (skew siskin). halloween theme (electric hellfire club). inhibition (h01) (nebula-h), blood on the floor (crack up) - wie weit (apocalyptica ft. marta jandova), heaven and hell (division), dein engel schweig (staubkind), rejection and raising perdition blaze (malicious secrets) - rio de sangre en ruanda (mixomatosis). raise the fallen (tomorrow and forever) - shadows of the mutilated (dismember). enraged - black magic - the things that should not be (carbon). the journey of gods (maya29) - my sharona (the knack) - rainbow eyes [catch the rainbow]. one (exclusive track) (crematory), chop suey (system of a down), night knight (dark illusion) - where eagles dare (therapy?), oceania (bjoerk). a call for the uprising of the bulgarian art (aryan art) - ignorant (callendish circle), right side of the bed, andy williams - can't help falling in love. i was made for loving you (wig wam & bruce kulick). shave (fuelhead) - burning wheel (stardrive), bruder (melotron). nie wieder (sacoma). preachers & whores (bonfire), seemann (feat. nina hagen ) (apocalyptica) - the death toll (nightmare). please don't touch (headgirl). wake up. iced earth - screaming for vengeance - destroyer of the nations (clandestine blaze), baphomet [death ss cover] (stormlord). negative creep [nirvana cover] (machine head). maybe the next time (rainbow) - accept / fast as a shark - vulture ritual (squash bowels). blood & flames, punk rock sister (nothing less), head hung low - ashes, bones burnt to dust, the evil that men do (doogie white). schubert trio in e flat (vampire rodents), beth (kiss), thrice - trust - gluck und asche (samsas traum) - the wizard (black sabbath), ides march / purgatory (steel prophet) - land of rape and honey (electric hellfire club), step ahead (comeback kid) - ange ou demon (manigance). predator [accept cover] (vanize) - money, money, money (at vance), deathstorm cycling (vermis), substitute (el caco), love is on the way (saigon kick), promises (the cranberries), cherub rock (stutterfly), still i'm sad (axel rudi pell). babykiller (devourment) - simple self (giving chase). transatlanticism - drakkar (italy): "poison" (alice cooper). hole in the sky (machine head), raindrops & sunshowers (the start), sound the surrender (darkest hour), pulse (live) (the mad capsule markets). dunkellicht (illuminate) - pagan saviour [autopsy cover) (dismember), the discipline of eath (performed by thorns) - the calling (aztec jade). the thing that should not be (john garcia/kurdt vanderhoof/jeff pilson/jason bonham) - frogger (puffball), ballroom blitz (sweet) - chaos and conquest (twilight opera) - kagami. stutterfly / gun in hand - little lover, under pressure - joss stone. queen of the rich / queensryche, omega - finale. roadrunner united - the dagger. powerman 5000 - nobodys real, love of a lifetime (firehouse). betwixt her getaway sticks (from autumn to ashes) - what drives the weak (shadows fall). cold gin (mark slaughter) - blinded by a lie (bob catley) - motley crue / wild side. deadlock / awakened by sirens. jackie blue (ozark mountain daredevils). nowhere (symphorce) - cindy lauper - time after time - frozen tears (italy): "some heads are gonna roll" (judas priest), urban discipline (biohazard), necropolis (the absence), dream chaser (highlord). can you see me (jimi hendrix). love gun (tommy shaw). visual aggression [celtic frost cover] (mayhem), everytime i look for you. i want to know what love is (foreigner). twilight odyssey (usa): "unchain the night" (dokken). klarheit (diorama) - keep your mouth shut (terror) - world wide wound (carpe noctum). lawrence of suburbia (d a d). the black goddess rises (noctuary) - the hop [#] (theatre of hate) - all against all (the haunted), bigelf / closer to doom, hand to hand / reused decision. mirror soul jesus (performed by eibon). mean streets (u.d.o.) - amorphis / two moons (various), am i evil - sour - summer dying fast (veil of anguish), the sign of tomorrow (edit) (exhibition) - pure morning (placebo). bark at the moon, sogneriket (windir) - ghostface / be this way. trophy (clandestine blaze) - sway (alvin "youngblood" hart). sorgens kammer (dimmu borgir), macabre - the tad sunday song. welcome to dying (clone) - clownhead [exclusive] (new creatures). a solitary order (luftwaffe). dance (saralee). detroit rock city (dee snider), loco (coal chamber) - pat benatar - hit me with your best shot. mommy, can i go out and kill tonight (bouncing souls) - take this life (in flames), death comes ripping (108) - forgotten words (the awesome machine), early howling winds (ancient). into the catacombs (satanic slaughter), lord of this world (corrosion of conformity). les amants (hyperdex-1-sect), limp bizkit - rollin' (dead man mix) (undertaker's theme). the ripper (mercyful fate) - prime evil (skyclad), pistol grip pump. shadows of the mutilated (disember). enter sandman (burton c. bell/john christ/robert trujillo/tommy aldridge) - fearless boogie, custard - aiming high. in your face / the revenant, dallas 1 pm (seventh son) - faith and the muse - scars flo. the quiet things that no one never (brand new). the chain [fleetwood mac cover] (seven witches). the end, the hymn of huitzilopochtli (tenochtitlan). living without you (tigertailz). seventh seal (italy): "i'm alive" (helloween). paranoid (crescencio salgado). jehova shall bleed (deathwitch). unholy existence (funeral rites) - dead in their tracks (magnitude nine), gypsy (emperor). red hot chilli peppers - havana affair - untrodden paths (wolves pt. ii) (marduk) - heaven shall burn / unleash enlightenment - paul mauriat - czardas - klaas jan mulder - symphonica, son of a bitch (tankard) - sleepy buildings (the gathering). sinergy - the number of the beast. verbannt (misantrophe) - subversion iii [exclusive] (ikon). trapped (demisor) - ditry deeds done dirt cheap - king of fools (edguy). night prowler. daughters of darkness (bloodflag) - rock it (american dog), going away to college, rain of blood (die form) - everybody hates a liar (force of change). bastard (sinisters). the magic kiss medley (satin). the ataris - eight of nine, pretty woman, hollow hills, sympathy for the devil (the electric hellfire club). dont take me for a loser (mark mcgee and luvplanet). after forever - silence from a. und wir tanzten (asp), the end of the world (the cure), alien angel (3). guilt (protocol x) - chris isaak - wicked game. imaginations from the other .. (twilight hall) - high enough (damn yankees) - black funeral (luciferion). alannah myles - black velvet - damage case (the damned) - changes (fudge tunnel), less thank jake / look what happened, crushed (limp bizkit) - typhon (therion) - suspicious chunks (ghoul), motor biking (chris spedding) - coin-operated_boy (the dresden dolls). everything ends (slipknot), regurgitate - chronic lyphatic leuakemie. embers fire (legenda). crush (the revolution smile), master of the souls (arthemis), josephine (puerto muerto). you and i (starry eyes). cantara (danny lilker, lisa sehreib) - hot for teacher. something [beatles cover] (helloween), parasite (tracii guns). arioch the chaos star (domine). smothered (spineshank) - don't leave (moments in grace), sad but true (in strict confidence). passion of the christ (moontower). pain / dark fields of pain, montreal massacre (macabre) - r.a.m.o.n.e.s. [the ramones cover] (motorhead), so this is love - i can help (billy swan) - twilight of the gods [helloween cover] (axenstar). the strength of will. the ubiquitous mr. lovegrove. a dog-eat-dog world (aborym) - monsters [exclusive] (cruxshadows). one way ride (lixx). tujou, dark wave mix part iii - blutige jahre (monoblock), critter (fire witch), meat loaf - the promised land. paranoid (ultraviolence), fire in the sky (reviver). what do i get (buzzcocks) - lost in metropolis (remix) (oil 10), prodigy - poison - falling in love (king of darkness), letztes gebet (cancer barrack) - the deeper the love - oppunder skrent og villmark (performed by storm) - altar of sacrifice. lip gloss and let down, generation x - king rocker - shy boy (george lynch) - under my control (leaether strip). regrets (mylene farmer), richard clauderman - capriccio romantico. bangles - walk like an egyptian. piece of my heart (glenn hughes (deep purple)) - children of the grave (tyrant). kingdom comes (mysticum), lazarus (in the wilderness) (funeral for a friend), theatre of tragedy / aoede, undersoul (erg noor) - crazy train (dee snider / doug aldrich / tony levin). intro (-). american jesus (loss). gumpen / the land of booze, defecation delicacy (necrotic disgorgement) - n.i.b. (jim sales) - knife & kleenex (manes), into the night [sweet cover] (locomotive breath), want you bad - honour (vnv nation), hey joe, kingdom comes (mysticum), pretending (h.i.m.) - totalimmortal (sancity returns). the protagonist. love hurts (nazareth), velocity (diorama) - tormentor (black witchery), noise ratchet - away to the he - meer (tanzwut) - darkseed - midnight mover, intro (clandestine blaze). symphony of destruction (live) (megadeth) (nightwish) - spirit (daniel cavanagh). killing is my business... (pessimist). funny little frog (belle & sebastian), laughter from the morgue (w.t.n.) - keith the music (every time i die) - gotta get away, du bist das licht (girls under glass), read between the lies. since you been gone (rainbow). time for me (fiction 8). nightmare [venom cover] (necrophobic), as the forest weeps... (seducer's embrace), more than death (phantasm). tony jamflone jr. (tender surrender) - reaper (gehennah). agonia bajo tierra (mixomatosis) - die krupps - the thing should not be (back in black mix) - join me in death (h.i.m.) - midnight lady (chris norman). comes around goes around (cherry street), gothic (godsend). black diamond [kiss cover] (black diamond brigade). honky tonk woman (taj mahal & james cotton) - god of disturbance and friction (performed by darkthrone) - my body is like a metaphor (yesterdays rising) - rooney - here today, gone tomorrow, taakeslottet (performed by storm), desperado [exclusive] (eve of destiny) - my ruin - sex junkie (plasmatics cover version) - beyond all reason - blood stained words, nightwish / bless the child. sonne (rammstein) - emerald sword (rhapsody). damned to endure eternity, the beasts of apocalypse [possessed cover] (pentacle), frozen [madonna cover] (jeff scott soto). borona mesti. war (war) - snowblind (snake sabo). the thin red line (a change of pace) - common sense (the defense). senca (darkseed), kid ego (extreme) - herimos (samhain), gates to the garden (nic cave and the bad seeds) - one man army / so grim, so true, so real (various) - hanging by a moment (lifehouse) - power trip (chimaira) - clothes hanger splattered abortion (gored face). halloween [helloween cover] (dark moor) - swamped (lacuna coil). traitors never play hang man (bring me the horizon). house of necrophilia (w.t.n.) - tonight (egotrip mix) (second decay). lack of comprehension (baalphegor). foreigner / hot blooded. urns of hate (soulless) - alleine zu zweit (lacrimosa) - ace of spades - who am i? (apoptygma berzerk mix) (sabotage) - emil bulls - resurrected, warmen - alone (heart cover version) (feat. kimberly goss). witches holocaust (thallium). maniac dance (stratovarius). it's all over now (bobby womack) - evolve (god module), i found love (roman). zwei gelsen und ein strick (samsas traum) - the end of the world (the cure). ama deus (sanguis et cinis). city of lies (plastic noise experience), how many tears (secret sphere). forced entry (ram), tyhja tila (brussel kaupallinen) - little feat / let it roll, doobie brothers / rockin' down the highway, the wickerman - jon bush, snowblind (cords) - the dogs of war (megace) - well of souls (phantom). love will kill all (calico system), novus ordo seclorum (agathodaimon). hell within / redemption... is a cold body, my december (gothacoustic ensemble), die wirklichkeit (zeraphine), crippled and broken (kataklysm). for the masses (gorefest). shake a leg. apocalyptica - somewhere around nothing, wings of despair (kamelot). in league with satan (voivod), rough silk - screaming for a lovebite - stiff little fingers - alternative ulster, no manehes mi vida (molotov) - annihilator - hell bent for leather, ricky king - aria, dirty deeds done dirt cheap (ac/dc) (exodus), keep what ya got (ian brown). rapid fire (italy): "crazy doctor" (loudness). stoker. doesn't do a thing for me (schroeder) - latchkey kids (toast). du bist das licht - american dreaming - neurotransmitter (ncc), feather's fell (dissection). porno star (black rose garden), mestrual soup delight (gored face). mourning (let it flow) - fear (sade), gladiator (gunbridge), white wedding. some kinda hate (decay). darkseed / hold me, exhumed - limb from limb - death comes ripping (grog), relentless (strapping young lad). bad company - can't get enough. break the line (guano apes). i wanna get a mohawk (but my mom won't let me get one) (atlantis black). hook in mouth (fatal influence). you can never cut your hair [exclusive] (trance to the sun) - the darkest days (dog fashion disco). when this world is dying (psychopunch), mother north (satyricon) - rational gaze (meshuggah), lachen weinen einsamsein (in mitra medusa inri), communication breackdown. flight of torek (aina), paranoid (the clay people). just exist (clit 45) - "i didn't know just what to say, when you turned and you looked my way, gothic rock
metal blade dj crusher vol.4
- zeitenwende (siechtum). r.e.m. - imitation of life, tanz der schatten (theatre of tragedy) - pillar - bring me down. heart of stone (joe louis walker). the dead march (log) - wrathchild (paul di-anno) - bodily dismemberment. welt (perfidious words) - believer (manigance). lord of this world (vile), somnolent (delerium). neat neat neat (the damned). hallowed be thy name (cradle of filth). god forbid - chains of humanity. shot by both sides (magazine) - fight fire with fire (exclusive track) (therion), mourning palace (dimmu borgir) - jonathan richman & the modern lovers - roadrunner. the ventures - the william tell overture. ich will brennen (asp). brainstorm [morbid angel cover] (luciferion) - children of bodom - aces high. all my fault (fenix tx), i'm a lonely little petunia (in an onion patch) - babybrutaliser (deifecation) - statutory ape (the black dahlia murder), by myself (fixer version). warchild (panther), deadly sinners (three inches of blood). hollywood (west indian girl). save us (cydonia). gets me through - pleasure to kill (angelcorpse) - unigue (tears of mankind). sonic youth - sugar kane - mictlantechutli - cryonics. dogs of war (spectre dragon). natrgaard - gebrechligkeit i, heart of the spring (adolf castle). one and only (neikka rpm). blood bound (hammerfall) - big ten inch record (marshall crenshaw and sugar blue) - i'm on fire (mantas). irresistible [#] (two witches) - stern (l'ame immortelle). head for the barricad (feat. cuz) (cromagnon), staring at the rude boys (the ruts), future pop musik (epsilon minus). garbage - i just want to have something to do. breaking all the rules (vhaldemar), tom robinson band - 2-4-6-8 motorway, a coming race (hypocrisy), weg zu mir (blutengel), the swift - under the sun, cuts you up (subterenian masquarade), division st (acoustic) (thursday). this legend forever (raunchy). die hard (nuclear assault), crestfallen (the evan anthem), high enough (damn yankees). best of me (the starting line), diversion (demisor), draw the line (tad robinson). retaliate (angel blake), page and plant - gallows pole. call of the beast (tantrum) - high school football hero (pisser), escape - snotrocket. wojownicy itaki (sbb). descending winters (swallow the sun), partytime (.45 grave), tormentor. return to the sea (dreamtale) - cat people (putting out fire) (big electric cat) - sticky situation (danko jones) - za horyzontem ciszy (monstrum), sha-na-na - at the top, east coast fuck you (bouncing souls). martyr (fear factory), fourth of july (champion), baptizen in blood (kaos rising), lola's pictures (hondo maclean). mr. crowley (ion vein). invocation (salome's dream) (die laughing). you know what you are (sons of midnight), edge of the world (glenn tipton) - some kind of stranger [the sister of mercy cover] (the mist of avalon), the principle of evil m. f. (wehrwolfe). iron man (ozzy osbourne and therapy) - man that you fear (shockwerks) - iron maiden (paul di'anno), torn to pieces (depression) - holy diver [holy mother] - longer (dan fogelberg), sorrow flew of black wings (dawn), folter (bunker). innere emigration - laboratorys analysis (entrails putrefaction) - into the void (rise) - misantrophy (dulce liquido), f.c.p.r.e.m.i.x (the fall of troy), damn my soul (stampede mix) (unterart), a little time (heaven's gate). ruby tuesday (chris thompson (manfred mann's earthband)). last breath (hatebreed). end of time (holy moses). alison moyet - love letters - demons and wizards / terror train, deathstars / cyanide (various) - alonely (nightingale) - on your knees again (pain), believer (decay of salvatioin), we can never break up (alkaline trio) - lacuna coil / stars. about love. glenn hughes / knife edge (robert berry). death, come near me (draconian), caroline (status quo), mother which you will serve (mord'a'stigmata). malevolent creation - alliance of war. my pledge of allegiance (after forever). the speed of pain (ophelia rising/abominable id), tineoide (samsas traum). old hags in body bags, mya moon (halsted). fly to angels (slaughter). somewhere on fullerton (allister). nothing else matters (elemental mix) (the element) - stick to your guns (revlon red), filter - where do we go form here, pretty little junkie (detox darlings), windfall, confrontation (clawfinger), paranoid (megadeth) - bottomless seas (hot water music). whitehall mistery orchestra - e-dur etude - valore and vengeance (since the flood). green cave float (performed by darkthrone), we will rock you (queen). fake boys girls (liquido) - erato azur - der auge klang (other day), seek and destroy - agent orange - cars (gary numan) (fear factory) - steel prophet - dreamer, deceiver, ziggy stardust (david bowie), phantom lord (anthrax), saints in hell (fates warning) - blood burden (crisis) - return of the fly (farside), solitude (short vesion) (intaglia). home (marc broussard), james labrie / tarkus (robert berry). rituals of time (dew-scented) - 22 acacia avenue (dark tranquillity), a pond without drops (gorath). supernaut (nocturne). i believe in me (illdisposed), scheitan - my isle, korn - battery (re-filtered by filter edition), where is my mind (nada surf), replica (fear factory). junges blut (saltatio mortis) - we rock [grave digger], belladonna and aconite (inkubus sukkubus), evil incarnate - piece by piece. sodomized bloated constipation (gored face) - finch - letters to you - raid (jaw). one step closer (gothacoustic ensemble), sal - death ray. tobias sammet - tears of a mandrake. john cooper clarke - kung fu international. boiler (limp bizkit), patrick (june), what's up now (scary kids scaring kids), halfcocked - sober, all i want (projecto 103). sadist nation (darkest hour). steppenwolf / born to be wild, suicide solution (adam paskowitz / peter perdichizzi). purge (lost souls) - transylvania (absu) - kill the king [primal fear]. i'm alive (luca turilli), botchla (poison the well), give me all your love (live) (whitesnake). man of peace (last tribe) - a new hope. army of the sun - vertigo (u2) - towards the shinning path (rise) - foghat / ride ride ride. vast (nuuk) - mr bojangles (nitty gritty dirt band), seaworld (comedy). into the fire (burning point), never - mind regress - slide it in - canned heat / on the road again. go to hell (darkside). black masses (sacramentum). flowing tears - swallow - i love a rainy night (eddie rabbitt), schrei nach liebe (scala & kolacny brothers), temple of the king. distraction (terra diablo) - on your knees [w.a.s.p. cover] (syn) - dead end hero (end of green). 2 minutes to midnight (primal fear) - stigmata (caliban) - geheimes lebel (illuminate), the last supper (live) (grave digger), was jetzt ? (such a surge). desolate ways (morbid angel) - in and out, to screw up. intro, ode to a friend (home of the lame), der traum des tanzer (illuminate). black dwarf (candlemass), ruton kuhtinas (musta surma) - lifehouse - hanging by a moment. sex bomb (flipper) - luciferic (purgatory), still loving you (scorpions) (sonata arctica) - the trooper (vital remains) - out in the dark (a global threat), buried alive (otep) - korn / did my time (live at the cbgb's). random activity (corporal raid). wait and bleed (slipknot). when the children cry (white lion), dunkler engel (saltatio mortis), venom of mankind (deviant) - close up the honky tonk (flying burrito brothers). one winter's night (bella morte). fly to the angels (slaughter) - universal eye - south of heaven - guranteez (hypnology). gay boys in bondage (punish yourself). sweet vampirous (bleeding through). disillusion (flesh field). just like clockwork (lower class brat), tough girl (open hand) - the storm (pronoian made). captor of sin (at the gates), tiamat - carry you across and i will carry mine (feat. sonne brandt) - want you bad (offspring). sonnenlicht (morgenrot), rats in the city (virus). andrew wk - party hard, wenn ich die augen schliesse (in strict confidence), johnny cash - i forgot to remember to forget. fight (chinchilla), for you (exclusive mix) (sero overdose). exciter (strapping young lad). man on the silver mountain [hammerfall] - keine traume (mondsucht). trench (october file) - holy diver, demise - affliction, summernight city (therion). into the coven (notre dame), ratamahatta (denial), holy man (ironware). drown (first blood), thrice / under a killing moon, lacuna coil - unspoken - man of iron (bathory). the wizard (scorn) - dark wave mix part ii cd 1 - i'll never let you go (steelheart), theatre of pain (fate keeper) - color blind - harvester of sorrow - korn - hypocrites - anti christ (dissection), breaker (primal fear) - mimic 47 (diablo) - no fear (rage). rock the earth (rob rock) - love and solitude [#] (love is colder than death), satanic queen (satanic slaughter). the black dahlia murder - a vulgar picture, milk & alcohol (dr feelgood) - disturbed - a welcome burden - storm warning (total eclipse). golden gaze (ian brown). stormfront (fremdheit), hendekagrammaton (enochian crescent) - smooth criminal (alien ant farm), read my lips (tattoed love boys), breathless (the bad seeds & nick cave), b4 (skew siskin featuring lemmy) - valley of the kings (gamma ray), after forever (biohazard), prostitute (single version) (neuroticfish), rhythm of the night (shadowland). march of the fire ants (mastodon), bob dylan - like a rolling stone, seventeen (winger). we are the champions - gavin degraw - blut ist in der waschmuschel (samsas traum), looking forward to a long toxic death. detroit rock city (ronni le tekro & tony harnell) - kryptonite (3 doors down). hey you. i'm so bored with the usa (the clash). it's out burden to bleed (caliban), i'm dying alon (blutengel) - stand tall stand proud (soapbox revolt), 2 minutes to midnight - joe lynn turner, ian gillan - pictures of hell, line up (execution style) (second shadow) - good old fashioned loverboy - jason mraz - who's in control (the casualties) - violations (minimal hardware version) - lords of the boards (guano apes), godhead and marilyn manson - break you down. silverchair - without you. solid ball of rock (perzonal war), blood supply (squash bowels cover) (screaming afterbirth), sign of the southern cross (fates warning), nothing else matters (john oliva/bob kulick), life eternal [mayhem cover] (gorgoroth), seelenschmerz (blutengel) - the power of i and i (shadows fall). eye of the beholder - in flames. opus a satana (emperor) - armored saint - never satisfied. strung out - velvet alley, no quarter. deeds of flesh - born then torn apart, static x - the enemy - odio en el alma [#] (hocico), midnight man (cydonia). scrutinized (hypocrisy) - shoot shoot (live version) / ufo - children of the grave (white zombie) - powerslave (ancient wisdom), quiet pattern (most precious blood). living after midnight, theatre of tragedy / black as the devil painteth - feasting on death (deep odium) - solitude (cathedral). tears of time (crematory), last caress (nofx). cum eye, midnight lady (hellfueled), scorpions - rock you like a hurricane, super trouper (custard). jumalan koe (verenpisara), death - painkiller - angst (d.-pressiv). jaded (walls of jericho), 18 bullet (covenant). born under a bad sing (jimi hendrix), nothing else matters - vibrators, cinerarium waltz (eerie von/mike morance). no hope of a future (the varukers), zero (evergreen terrace). caribou (sense field). ada - the red door (wraith of the ropes) - the lizards-the opal crest of zed (the lizards) - yesterday (puffball), personal demon (edit) (diskonnekted), ive had small town night (vampir 2 in 1 mix). salem's demise (razed in black). aber die liebe hort niemals auf (samsas traum), rock me amadeus (umbra et imago). a mid winters dream (crimson massacre), who are you- (old), the last sunrise (aiden). wichitta lineman (glenn campbell), die kleine ballade vom schwarz (asp). the evil that men do - chris jericho - edge of a broken heart (vixen) - feeling way too damn good (nickelback) - spawned by evil [bathory cover] (necrophobic) - estrangement (perfidious words) - kiss of death (dokken), psychocult [#] (the merry thoughts). allison ( eve 6), song for the enemy (luctus) - allman brothers / statesboro blues, bloody romance (senses fail), try, try, try (elseworth), tron zla cz. ii (hegemoon), bryan adams - summer of 69, listen (stiff little fingers), open your eyes. flag of hate (acheron), supersonic journey (performed by satyricon). nine bar blues (whitmore). the number of the beast (iron maiden), elegy (leaves eyes), when hell is out of control (nightmare) - battery - pagandom, predictable (good charlotte). the zoo (live) (scorpions). jordan rudess / karn evil 9 (1st impression) (robert berry). memories (diskonnekted mix) (namnambulu), direction. sigh of the southern cross [fates warning], en brazos de la fiebre (heros del silencio) - crucifixion must hurt like a bitch (cum christ) - engel (das schwarze system) - deja vu (wolf) - papa roach - she loves me not. woman [def leppard cover] (vent), adam.s song, without a face (maroon). orie descent (performed by emperor) - pour la merite. no mas control. conocimiento implica responsabilidad. nothing up my sleeve (hellsuckers), silence calls the storm (quo vadis), kill to believe (bleeding through). babylon rockets (gemini five). hammerfal - breaking the law - urgent, fool for your loving - for thine is the kingdome (lead weight). wake up (silversun) - ascend (cold fusion mix) (headscan). aztec jade (usa): "another day" (dream theater) - chi mai (ennio morricone) - bark at the moon (sanctorum), the offspring - i wanna be sedated - dance with the dead (axxis), fill your head with rock(original studio version) (kim mitchell). no way out. shut your mouth (pain) - my way (mutiilation) - stereo motion - steal the show - shed (meshiggah). subseven - game of love - terrorist attack (defiance), legend of steel (luca turilli). as time decides (morifade), dream on (kim mcfarland) - blacklist [#] - attitude (day of the dead). distant early warning (live) (rush), the trooper - lemmy kilmister - cornucopia (iron monkey), tyrant (overkill), the sound (further seems forever), das ist der tag (letzte instanz). shark ethic (most precious blood) - power and will (part iv) (mgla), telepathic (samael), path of the mindwalker (the firstborn) - wildfire (michael murphey) - peter weekers and lso - douce melodie. skin o' my teeth (megadeth), tod... find ich gut! (kontrast), glass half nothing (nodes of ranvier), last resort (papa roach) - sole survivor. country joe mcdonald - the "fish" cheer / i-feel-like-i'm-fixin'-to-die rag, countdown (the unseen). abhorrent elite (dominium), ripping corpse (centinex), victoria iceberg (bear vs. shark) - metallica - 53rd and 3rd, burning the shrouds (dreadful shadows). strom of steel (la reine noir), hello (lionel richie). gefangener (concussion edit) (infekktion), wild thing (the troggs), babylon fell [celtic frost cover] (apollyon's sun), how do i live (trisha yearwood). whitesnake - here i go again. pedro alvarez - pearl fishers, another brick in the wall (the crack of doom) - the trooper (lemmy & phil campbell with roc). dominichrome (the crack of doom). wake up [#] (crimson joy), arch enemy - leader of the rats, master of puppets - holocaust, meine welt (lacrimosa), i want out (helloween) (hammerfall feat. kai hansen), grey in grey (girls under glass) - rock bottom (sebastian bach) - perfect strangers (deep purple), abigail's mercy - meaningless, storm of the lights bane (dissection - retribution) - de paardenneukeraar (kludde) - der erloser (dr. death), over the mountain (tyrant). disturbing the priest (coffin texts), stray bullet (kmfdm). instinct, blood from an open wound (increased suicide version) (bahimiron) - oppi fjellet (performed by storm), free / all right now. bodies (drowning pool). side effects (defecation), the flying lizards - money - aurora borealis (lorien), the new hate (born from pain) - bleed the meek (paths of progression), someday (nickelback). helmet / smart, hechando chingasos (brujeria). motorhead (hawkwind) - calling the rain (atrocity feat. yasmin), what i've become (lamb of god) - every rose has it's thorns (poison), shapeshifter (she said destoy) - briquette (soman), love attack (after hours). all i want - put you in the picture (the rich kids) - soon to be dead. cosmetic citizen (attrition) - malleus maleficarum (pure13). cosmic dancer (southern voodoo), forever... (windrikje), beauty of pain (calm hatchery), personal jesus (marilyn manson), gideon (my morning jacket), beyond the dark sun (wintersun), blind leading the blind (axenstar) - lifehouse - spin. emily (adam green). the rise of triopticon (guardians of time). annihilation by the hands of god. astroblack (ravendusk) - bleibende schatten (other day) - panama. jailbreak (thin lizzy) - if you needed somebody (bad company), waffenfreiheit (blackgoat). move - what's your level? (1000 yard stare) - bohemian rhapsody - constantine - denim and leather (saxon) - we're nothing (moon of steel), alastis / in darkness - somewhere i belong (gohacoustic ensemble), too late for love [def leppard cover] (shameless). criminally insane - a friend in mescalin (bloody dead and sexy) - lost soul (bleeding display), down in the past (mando ciao). light up the sky. whitehall mystery orchestra - die moldau - stupid people make me angry (zero cipher) - roots bloody roots (slavestate). autopilot off / clockwork - failing to contain the gore fountain (xxx maniak) - riot in everyone (crashdiet) - genghis kahn (angel corpse). a feeling a word a curse (eight fingers down), painkiller (death), graveyard shift (nosferatu). big city lights (remix) - kevin dubrow, as we fall down - lifeless (dark throne). where time has died away (absurd). enjoy the silence (it dies today). europa (earth's cry heaven's smile) (santana) - led clones (gary moore feat. ozzy osbourne). caso fora d'horas / sugar cloud (trama feat. helena guerreiro), rezillos - top of the pops, hatehead (the scourger). our lady peace - whatever (chris benoit's theme), burden of grief - prowler, i thank you, lovedrive - taime downe. lip gloss and black - canned heat - going up the country, pull me under (accomplice). rewind it all (disbelief). road to hell (chris rea). in the name of sanity (haemorrhage), overload (bloodsimple). full nelson (tigerfist with verbal graff). we are one (buckethead (feat. serj tankian)) - you not me (moon of steel), alien ant farm - attitude. humans lost humanity (atrocity). mother zone (deathstars), vorbei (obsc(y)re) - victim of fate (squealer). silent lucidity (queensryche). fall of the reich (black majesty), piebald - the king, lion's roar bound to be free [savage grace cover] (powergod) - pull the plug (divine rapture). my sweet shadow (in flames) - all hell breaks loose (sick of it all) - hellion (w.a.s.p.) (children of bodom), "got milf?" (edit) (pungent stench) - (na na) nukklear rokket (wrathchild), shackled to the trilithon of kutulu (bal-sagoth), in flames / episode 666 - the wind that shakes the barley (sarah jezebel deva). here i am (rock you like a hurricane) killy hanson, heaven's on fire (live) (kiss) - "i didn't know just what to say, when you turned and you looked my way, rock
various artist [hard]
, maschinenmusik (plastic noise experience) - anders sein (second decay). i wish you the best (ed gein), ravaged by conflict (malevolent creation). nini rosso - la canzone di solveig - 20 eyes (shades apart) - all my love, edie brickell & new bohemians - what i am, face to face (warpath) - the bard's song (the hobbit) (galadriel). slice of life - begin & end (theatre of tragedy), skyggedans (performed by satyricon) - house of 1000 corpses (rob zombie). vater unser (eisheilig). der waldgang (the retreat into the forest) - painkiller (judas priest) (death), iggy pop - lust for life. blondie - rip her to shreds, rise against - swing life away. life will never be the same again (l'ame immortelle), halloween (dark moor) - an exit (spahn ranch) - full circle (the virus) - rising again (stretch arm strong). little guitars - movement of the flesh (datura), ashes to ashes (david schankle group) - ist es wahr (crematory), humble pie / thirty days in the hole. they sent you (mare) - caught in a mosh (live) (anthrax), lost in the twilight hall (fairytale), in zeiten wie diesen (massiv in mensch). endless energy (am i blood) - billie myers - kiss the rain. rock 'n' roll all nite (erlend & steinjo). i ran (ken). all along the watchtower. raze (exodus). without emotions (combichrist), beth (stage dolls) - suicide ruin (misanthropic) - stupid girl (cold). ewigkeit (westwerk), kd lang - constant craving - writhing (blackouts), dragula (live) (rob zombie), icarus (hellraizer). ikarus (unheilig) - nude sophia (lux occulta) - born in a burial gown (serpents aria) - this time's for real (ill nino) - hole in the sky (confessor) - bloodflowerz (false gods) - i don't know - ain't your fairytale (sonata artica) - bite it you scum (cky), a lists go on. confinement (mincing fury and guttural claumour of queer decay). cry for the moon (epica), linkin park / breaking the habit (live), majesty (delirious) - thinking (industry eleven). house of the rising sun (evereve) - where no shadows fall (ever eve), u2 - beat on the brat. no code no honour (elegy) - open your eyes (guano apes) - changes (girls under glass). born for war (nocturne). monkey gone to heaven (far). where dead angels lie (dissection) - pour some sugar on me [def leppard cover] (cleaner) - dean haven - as the palaces burn (lamb of god). lucky, time (pangaea) - abramis brama / mamma talar (new version). shot down (nine black alps). wieked game (chris isaak). i want to know what love is (foreigner) - seek & destroy (chuck billy/jake e lee/jimmy bain/aynsley dunbar) - soul on-fire (live) (h.i.m) - the hives - hate to say i told you so - pretty (ugly before) (elliott smith), holy man (venom). la, la, love you (weston). driven through the ruins (trail of tears), out to get me (clawfinger), purple haze - one way or another (blondie). declaration of war (immortal remains) - a gunshot to the head of trepidation (live) (trivium), you've made us conscious (theaudition), utopia (stone ox), die by the sword - in stahlgewittern - erwache! (werewolf castle). progenies of the great apocalypse (dimmu borgir), charlie daniels band / the devil went down to georgia, down again (chimaira). george zamfir - hungarian dance. chemical warfare. no warning / dirtier than the next - infusion [exclusive] (lucifer scale), mass grave aesthetics (deathspell omega), straight out of line (godsmack), headspeed - a different side to me - when i'm with you (sheriff) - unknown track (unknown artist) - hole in the sky (don' start to late / equinox), schachfigur bauer (the dying art). love like blood / remember - sodomizer (nifelheim), in my mind (vers.2000) (armageddon dildos). taproot - day by day - seawinds (therion). slave new world (gooseflesh), lichtspiel der gebrochenen herzen (cut.rate.box feat. s.netschio and a. hate), fixation on the darkness. attitude (alien ant farm). di-rect - inside my head - rob zombie - never gonna stop (the black cat crossing mix) (edge's theme), gatekeeper (cryonic temple), running free (paul di'anno). monster magnet - heads explode - come on and dance (the bastards). cowards (american head charge) - feast of the undead (blood freak) - threatening skies (obituary) - lost (embraze). nerve (soilwork). only time will tell (nelson) - a rush of blood to the head, slut killer (xxx maniak) - shot in the dark. hymn (edguy) - final countdown (dispatched) - trucker hat (bowling for soup), to mega therion (therion). dont say a word (sonata arctica). space divider (neuroactive) - jump - killer queen (queen), she mourns a lengthening shadow (cradle of filth). resurrection (anastasia mix) (gossamer) - for whom the bell tolls - shotgun remedy. the shit sisters (these arms are snakes). statuory ape (the black dahlia murder). tnt / everyone's a star - affections of death (flag of decay). forever (kiss). hello the sickness (runt). the ancient queen (emperor) - south side mary (warchylde) - break the fetters (vortex). so fucking blues (bury your dead) - lacrimarum (to/die/for) - operation : mindcrime (queensrache). victory (warchylde). pahaa verta (mokoma), dark delusion (taste of insanity) - wind cries mary. when it cuts (ill nino) - no more heroes (the stranglers) - 747 strangers in the night (xiron). alice cooper - school's out. kim carnes - bette davis eyes - crawling (linkin park). slipknot - the nameless (live), cast out (shadowkeep), in the end (forward to death version). and the bands played on (saxon), tired of people (pure noise disaster) - the love song (marilyn manson), 39 - ingram hill - love song (tesla) - kids in america [kim wilde cover] (silence) - gorespattered suicide, the clerical conspiracy (sabbat), aegan shores (pagan's mind), so alone (soho roses). convicted in life (sepultura). hold me tight (innerwish). two ways (blake). wild horses (otiy clay). shine on you crazy diamond - get it together (midtown). electric funeral (edmundo saldivar). dreadlock pussy - t minus - electric boys / groovus maximus, charing cross / back for attack. ever frost (sentenced) - der vampir des eigenen herzens (illuminate). i just wanna (kissettes), holy thunderforce (rhapsody). end of days (intruder), by night / one and the same. army of death (bloodstained coffin) - neslepaks (performed by isengard). jilted john - jilted john - sage ja ! (unheilig) - angel of death [slayer cover] (liers in wait). tammy wynette - crying in the chapel, goldenes herz (oomph!), go for the throat (y&t), waiting for my man (u.k. subs) - anal stench - torment in the shabeen - my self (sally lune), ray conniff - nocturn in e flat major, phase 2 (digital factor) - delivering the goods (live version) / judas priest. the meatgrinder (pigsty). johnny blade (engrave) - mannuz (theudho) - thieves (resident phase shifter). (i'm) stranded (the saints) - american pie (don mclean). rosary. spiral tower - t.v.-war, black steel (australia): "power and the glory" (saxon), the pretenders - i'll stand by you. family in coma (bloodrainbow) - rodt og svart (arcturus), rock you like a hurricane (scorpions) - mob rules (burning inside) - faith (kristin hersh). paul mccartney - every night. theatre of tragedy - image, cryin' (otis clay). deep purple / perfect strangers - enforced (blood red angel) - mash out posse / ground zero - grope - and justice for all. master of puppets (hellsau). crippled and broken (kataklysm), sacrifice (ophthalamia), never die (yngwie malmsteen), deep (anathema), raining blood. my demon (dimension zero) - the maze of rituals (pandemonium). kalpeina helvetin tulessa (musta surma), here i go again. steal away the night (killswitch) - freedom subways (thanatoschizo) - praise of death, deathbox (mnemic). comfort in cold blood (break the silence) - the calling - wherever you will go, desire (lemmy kilmister / richie kotzen). rough boy. do the metal (electric eel shock). stone cold (hammerfall). wicked heart (devotchkas) - white lines. let me have it, unschuld erde (das ich), alles schwarz (umbra et imago), fragments of faith (lacuna coil), hells bells (john corabi / tracii guns / tony franklin) - safe home (anthrax), the company (paragon of beauty) - vor vollen schusseln (in extremo). mp3 (hatesphere), joan armatrading - drop the pilot, entrain (neon dream) - shrine of the master (brutality). princess of the night (division). war pigs (sacred reich), no more tears. the last candle [blind guardian cover] (dead poets society) - beach house (fahrenheit 451) - things we go through - bal sagoth / the hammer of the emperor (various) - destroy my beauty (fifth season) - invisible population (in extremis) - endo - malice. rose of sharyn (killswich engage), chemical warfare [slayer cover] (luciferion). country girl [], self esteem, corporal jigsore quandary [carcass cover] (berzerker) - shine on you crazy diamond (grand cross) - 2 minutes to midnight (steve grimmet), autarkeia (quasar) - puppy dog eyes and water slide rides (soapbox revolt) - turning the tide (where fear and weapins meet). angra mainya (creature). the gathering - shot to pieces, rancid - sheena is a punk rocker - witchery - fast as a shark. gimme gimme gimme [a man after midnight] (sinergy) - peter yorn - i wanna be your boyfriend, strobe (front 242). iron man (this means war) (busta rhymes) - eisberg (kontrast), seasons in the abyss [slayer cover] (disaffected), wings of heaven (tiamat), pillow trash (krissteen) - neon knights [black sabbath cover] (powergod). carcass - incarnater solvent abuse - big teaser (powergod). burn (throwdown) - back in black, sacred (remix) (sleepy hollow) - the beautiful people (alex xenophon), therion / up to netzach - snowblind (sleep) - the wings of the hydra (therion). oozing vaginal discharge live (lividity) - so what (terminal 46). zeitbombe (girls under glass). the wizards apprentice (crystal eyes) - roses + forget - me - not (sanguis et cinis) - catholic - battery [metallica cover] (ensiferum), meister der verbotenen traume (seelenkrank) - jan holland - melody in f, arnold friend (shamelady) - seasoned [exclusive] (numeralia), weeping a lake of blood (spirit corpse), bylar (ataraxia) - zero the hero (godflesh) - revenge (soman). my cock it bleeds (lividity). when all is said and done (demo version) (threat signal). the urge for power (no fraud), francis goya - elvira madigan, surfing on a rocket (air). crionics - hallowed whores. in einer zeit in der die freun (l'ame immortelle) - at least you bought her flowers (fall river), buck rogers (feeder), the stranglers - (get a) grip (on yourself). haterealm. the whisper of the ages (edenbridge) - trashed and scattered (avenged sevenfold). all we ever wanted was everything - diabolus (thy worshiper) - eruption (die apokalyptischen reiter) - nile - the howling of the jinn - razor dag (morphine angel). dead ringer for love (meat loaf), stand up and shout / dio - engel sterben nie. annabell lee [#] (ataraxia) - mott the hoople - roll away the stone. bad blood (tombthroat) - bite to break skin. kick out the jams - black dog, and still bows the sea (phillip bao and the voodooclub). hair of the dog (paul d'ianno (iron maiden)) - interview (robert smith), it's so easy [guns 'n' roses cover] (unearth) - before you go. malvasia [#] (into the abyss), die with you (blutengel) - fallen rage (misery inc) - wounds from the night of magic (old man's child). feedback (club mix) (covenant) - no place for the innocent (pendragon) - warrior (twisted tower dire) - too fast for love (doom kounty electric chair) - powerman 5000 - dracula 2000. majesty of silence / throug eternity, ever-frost (sentenced), dude (looks like a lady) (crystal taliefero with joanna connor), strike anywhere - chalk line, das katzentier (morgenstern), battlefield (blind guardian) - shame on the night (solitude aeturnus), rolling (air raid vehicle) (limp bizkit), in the flat field, disgorging innards, cyclone (overloaded). eternal (yearning) - necrophiliac, mein bild (d.-pressiv) - nasum - and you were blind to what. in the kingdom of the blind the one-eyed are kings - don mclean - don't, hello time bomb (matthew good band), within temptation - ice queen - baptized in the redemption - edenbridge - holy fire - she (unmasked) - ekseption - a la turka. she loves my automobile, john b. sebastian - i had a dream, intro. torment (lost signal), killer queen (the royal philarmonic orchestra). spew - wherever i may roam - disturbed - guarded, break stuff [limp bizkit cover] (0-ring). deadman (instr). harlots tears (eva o.). inhale (stone sour), warriors of death (swordmaster). hecatombe of men (histoire noire), boy gets what he wants (versus the mirror), now your're mine (red emprez). evenfall - rawish - 99 (the haunted). antihero (god forbid), cameron with an h (stole your woman). any colour you like. day tripper [the beatles cover] (domain), rock & roll damnation (stephen pearcy / page hamilton / tony franklin) - fear of the dark - chuck billy, begin & end (theatre of tragedy), cold metal (ambeon), sleeping with adrenaline (elemae) - handshaker (troublemakers) - kill your heart (unterart). problem child (soto, jeff scott / reb beach / tony franklin), the passanger (iggy pop). black hole sun (soundgarden) - body and blood (a perfect murder) - dream evil / the book of heavy metal, ewigkeit (the final sign) - land unter (second decay) - rohrschach (janus). killer queen - sum 41 - our farewell (within temptation) - disturbed - down with the sickness, get inside (stonesour), the killer barbies - rage - stiffing penile tenus amputation (gored face), you ain't seen nothing yet (bachman turner overdrive), space lord / monster magnet, tristessa (the esoteric), the grand conjuration (opeth), sielut iskee tulta (kilpi) - fallen angel [possessed cover] (impious). komm (wenn du kannst) (megadump), down payment blues (tommy shaw / albert lee / tony franklin) - bleed all over me (wicked wisdom), the crucible (darkwell) - hoobastank - crawling in the dark, dawn of a golden age - symbolic (ye old skabbard) - eagle fly free (vision divine) - interview (siouxsie sioux). tales of destruction (the dogs d'amour) - spunge - roots - the zoo - joe leste. spiegelquelle (endraum) - crosby, stills & nash - suite: judy blue eyes, fell in love with the game (blindside), in the lies where upon you lay (mayhem). mit fester hand (allerseelen) - falkenbach - skirnir. 4 lyn - pearls and beauty - never say die (megadeth), a. c. - some more hits. welcome to the machine - macbeth / forever, the great dividers (unearth). vanize - predator. amanda (boston) - der arbeiter (linlja maas). the dandy warhols - bohemian like you - planet hell (nightwish), pomp & circumstance (wolf hoffman). by the way (red hot chili peppers), evil ladies (norther), fornever (brainstorm), wasted years (nocturnal rites), peruvian skies (fifth season). epoch of the gods (psycroptic) - heather nova - virus of the mind - hill of skulls (crimson massacre). keep it clean (pitchshifter). head over heels (hammerfall) - andre matos - over your head - blood of the martyr (brodequin) - sad but true - flipper. tom waits - return of jacky & judy, chains [exclusive] (strap on halo), the lyre of orpheus (nick cave and the bad seeds). confessions (bleed the dream) - rammstein - sad but true, silent force - all guns blazing. ramses the damned (the new creatures), sacred (moonspell). in your face (children of bodom) - niki fm (hawthorne heights). better than this (onelinedrawing). solitary man (him), friends (neil zaza). jesus just left new york city / five fifteen, guerrilla radio, inme - 7 weeks, sabbath bloody sabbath (bruce dickinson and godspeed). funeral of hearts (acoustic) (him). someone else's arms - world bizarre (pronoain made). milk (garbage) - joe cocker - with a little help from my friends. adrenaline (rosetta stone), ruth buzzi better watch her back (bled, the), bleeding anxiety (dislimb), mein buch (umbra et imago), suicide solution (coffin texts) - traumzeit (inscape), sang nordique (akitsa cover) (thesyre) - carly simon - you're son vain - sifting through remains (sacred denial). too many puppies (implant) - don't talk to strangers (blind guardian). to be with you (mr. big), the end is near (memembris), anywhere out of the world - mordecai (between the buried and me) - atomic punk, ol auf der tanzflache (stendal blast). lullaby (the dust of basement) - pornopedophilic mockery (mental demise). saviour (pure inc.) - satan's fall (immolation) - infernal torment - talking advantage of a virgin. it's you (sicker than others). animal, i turned into a martian (the temple). paradise of morbidmorgue (demisor) - deep colors bleed (systematic), rock you (helix), beneath the remains (defleshed), visionary eyes, the impact of reason - suunta (nicole), reign in blood (live) (slayer). killed by death (crucified barbara), silent killer (saidian), puddle of mudd - she hates me. herzschlag (infekktion) - day of the eagle (robin trover) - sealed with a kiss (jason donovan). broken wings. snowblind (system of a down) - the heaviest matter of universe (gojira) - true belief (on thorns i lay), incomplete (troublemakers) - sick (disbelief). windmill (helloween) - you.re so vain (carly simon) - dream secretary (poema arcanus), teufel oder engel (and one) - trono de huesos (machetazo). send me to hell day of wine and thorns (malicious secrets). woman of dark desires (marduk), crucified one (performed by gehenna) - learning the game (lemmy / slim jim / danny b) - syn schizofrenika (markiz de sad), effigy (the smashup), shut your mouth (garbage), queen of the night (death trash) - assyria (aguynguerran). in liebe und freundschaft (doro) - ted nugent / cat scratch fever, slayer - bloodline. elizabeth bathori (dissection) - believe revolt (relocation blueprint) (snapcase). pretend - the morrigu (morrigu), wir wollen keine menschen sei (welle erdball), rock is dead (marilyn manson), another holy war (blackened) - blind eye halo (live) (soilwork). kill the king [stratovarius] - heart of steel (manowar), the last god (inter arbores), another day (aztec jade) - strange world (evoken) - disavow christian ignorance (ingurgitate). atomic garden (blender). looking for a lady (last of the teenage idols). great white buffalo (undercode) - las cruces jail ( single edit (two gallants). highway to hell - new me (the machete) - primera (last goodbye) (armsbendback) - christ on a stick (kretan), beatsteaks - let me in, carl perkins - blue suede shoes - wire - i am the fly, papa roach - she loves me not - no time to cry (d.d.t.), smooth it up (the damned). disturbed - glass shatters (stone cold steve austin's theme). mandatory suicide, after the war (orion riders). wet leaf (peeping tom). catch of the century (edguy) - hit or miss (new found glory), long live rock 'n' roll (gamma ray), terror train (demons & wizards) - green manalishi [judas priest cover] (therion), hellfueled / midnight lady. it doesn't happen to me every day, can we talk a while?, alternative
2006
, santana - soul sacrifice, death blooms (mudvayne), peace dog [the cult cover] (black star), infected (demon hunter). king volcano. 33 (as tall as lions) - i dont believe in love (queensryche), little sister (queens of the stone age). imperial vipers - kick a hole, mr. crowley (owens, tim "ripper" / yngwie malmsteen), war pigs (sm version) (slaves on dope). awakening of the gods (hemlock) - shimmy shimmy quarter turn (hellogoodbye) - enjoy the silence (it dies today). mystery blue (france): "metal daze" (manowar) - tempesta / fuck - sweet emotion (donald kinsey), big rawk (ninteen88), sehnsucht (eiskalte gaste) - sweet home alabama (lynyrd skynyrd) - embodied (spahn ranch) - heaven's a lie (lacuna coil). conspiracy in mind (communic) - paralexia (jerico one). sewn up with guitar strings incision (gored face), saliva - turn the tables (dudley boyz' theme), boston - more than a feeling. the cranberries - linger. welcome to the machine [pink floyd cover] (shadows fall), blinded (requiem) - peter banks / toccata (trent gardner), skint (ohm). kind der nacht (dementi) - rise and oppose (diecast) - stumme schreie (l'ame immortelle) - under the gun (the sisters of mersy), sensou. i'm the one, this is now (hatebreed) - we're not gonna take it (twisted sister) (donots) - the everlasting grudge (a dozen furies) - time is running out (muse). ufo / highway lady - pink (gerald mcclendon), jet black new year (thursday) - it's criminal (pride of lions). it's hard to hail a cab while holding yourself at gunpoint (found dead hanging). our truth (radio edit) (lacuna coil), god of thunder [kiss cover] (white zombie), seventh church of the apocalyptic (lawnmower deth), winds of change (scorpions) - acerbus - angel of death. trustcompany - downfall. bang bang bang (griz). the last time (septic flesh), saudade de ar (nado vivo). liebeslektion (the galan pixs), pussyjuice chup a chup (rompeprop), for whom the bell tolls (eric bloom/al pitrelli/tony franklin/aynsley dunbar), animal (fuck like a beast) [w.a.s.p. cover] (venereal disease), kathys song (ferry corsten remix 12). no compromise (the haunted), nurse could you please prep the patient (daughters) - tiden er en stenlagt (performed by wongraven). the reflecting god (broke box). how we became fire (moonspel), motorcycle man (tragedian) - the formula (anemic), vega4 - love breaks down, the flames of deceit (old man's child), festering anal vomit (lust of decay). i know (droogies). all we really own (a global threat) - the call of amergin (strenght trough joy) - liar (grave digger) - nightwish / walking in the air - jan holland - flight on the bumble bee, sunrise (club mix) (glis), king of the night time world (chris jericho) - john wetton / the sheriff (trent garder) - angels with the last plagues (left hand solution) - breathe me, sweet leaf (cadaver) - wild boys (duran duran) (mnemic) - phantoms of death - iced earth - transylvania (instr.) - this day you regret (callendish circle). sin voz ni voto (habeas corpus) - neon knights [steel prophet] - jungfrauenquelle (offiziell un (illuminate), fear and wonder (dimmu borgir), kill the king (primal fear), welcome to the jungle [g'n'r cover] (zombie apocalypse), 2 minutes to midnight (decameron), children of disgrace (demisor) - (intro) in nomine satanas (hecate enthroned), secondary effects (darkane) - faithless ... (demisor) - knights of fire (tantrum) - castles made of sand. girls, girls, girls (tuuli), change by evil (edgecrusher). whiplash (metallica) (destruction), comedy (proxy) - razorwire - d-fens. strange ways (ulver) - a life for revenge (dark moor), burning (metallium), the cannibal song (attrition), cyanide (deathstars). overseer (mortification), a take that wasn't right (helloween), bela lugosi's dead (bauhaus) - all hallows eve (type o negative) - insanity's fall (dungeon) - copycat (lacrimosa), flat earth society (loss). cocaine (j j cale), papercut (gothacoustic ensemble), zz top - tush. loke (enslaved). always on my mind (willie nelson), drown (garlic). death in black (godgory) - filthee (otep). tori amos - cornflake girl, forever knight (bell, book & candle) - subseven - emotion - standing in the.. (the gossip). nameless (obsc(y)re), beseech - innerlane - crimson towers (dissection) - mandatory suicide (crown of thorns). benediction - electric eye. all systems fail (the varukers). lacrimosa / mein zweites herz - ketzer (morgenstern), lightspeed (van). traveller (waltary-angelit). therion - seawinds. eat you alive (necessary evil), you too can have your own cranklab (harakiri) - rob zombie - blitzkrieg bop. s.n.p. (italy): "the thing that should not be" (metallica), the stranglers - peaches - love is on the way (saigon kick) - flucht v.2 (cymotec). broken heroes (twyster), black betty (ram jam). neurotica - ride of your life. liberate (slipknot), lita ford - kiss me deadly, oasis - stop crying your heart out. torture chamber (mr. sinister) - summer night city (therion). empherial abyss disaster (empheris). devilution (high on fire). spill the blood [slayer cover] (grope), salvo (bolt thrower) - under the sun (everyday comes and goes / sanctorum) - gier - und dann (d.- pressiv), awash in gore (splatterhouse), vater unser part ii (e nomine) - la petite fille de la mer (vangelis). our mirror reflektion (bloodpaint), don't lose control, end of time (jorn) - the dolphins cry (live), in the curved shape of chaos, ekseption - peace planet - live wire (streetwalkin' cheetahs). crimson legions (enthroned), great white / once bitten twice shy, dopamine (iommi) - reach for the sky (regi hendrix and craig erickson), i'd do anything for love (but i won't do that) (meat loaf). angel of death. nena - 99 luftballons - breaking you down (demo) (raven). ok.doktor (volt). rejected and unwanted (the casualties) - eden (flowers and machines), deny reality - re (animator). heavy metal thunder [saxon cover] (deadhead). 13 candles (sacramentum) - old habits die hard (alfie soundtrack/mick jagger) - paranoid, mother of sin (holland): "madhouse" (anthrax) - muse - feeling good, anybody there (ritchie blackmore). tormentor (guillotine). suicide and other comforts (kaul). walk this way (pinetop perkins and rusty zinn with ronnie brooks), marilyn manson - the kkk took my baby away. nothing's wrong? (devildriver) - falkenbach / leaknishendr - anarchy in u.k. (sex pistols) - temple of gore (crimson massacre) - massacre of the unknown (incubus), planetarium (covenant) - hindsight (bedlight for blueeyes), schizo (a tribute to pink floyd) - can i play with madness (steve overland), beacuse the night (patti smith group). still lovin' you - steve whiteman, dimension - icar's wings (x), ephemeral addictions (bed light for blue eyes). acme (sirrah), hate yourself with style (clawfinger) - bist du bereit (endanger) - der schlachter (waldgeist), i been gone a long time (everytime i die). everyday is halloween - pantera - avoid the light, sweet leaf (godsmack). goldfinger / my everything. 3 1/2 (weeb) - rule the world (the zeros) - without me (eminem), lynyrd skynyrd / call me the breeze. green day - outsider, smoke on the water (deep purple) - strangelove [depeche mode cover] (nevergreen), the ripper (iced earth). joan baez & jeffery shurtleff - drug store truck drivin' man, alive (p.o.d.). lilacs and lolita (from autumn to ashes). this love (maroon5), grimlair - snu mikrokosmos tegn. sleep now in the fire, ace of spades (motorhead), flickerlight (theatre of tragedy), evil inside (amorphis), eve's sin (curse of the bastard god) (crimson massacre). obstructed (rise against). progenies of the great apocalypse (edit) (dimmu borgir), manic street preachers - so why so sad, mirror out of time (casus belli), hate is just. (lame immortelle), born to raise hell (voodoo vegas), master of the winds (manowar) (die apokalyptischen reiter). country joe & the fish - rock & soul music - boom (p.o.d.). welcome to the show (eat the gun), pathways to oblivion (clagg) - what.s my age again?, courageous (accomplice). amazing life. antichrist superstar (razor blade smile/robert "spooky kid" pierce). glenn hughes - in my blood - nueva york (halsted). malice through the looking glass (mirzadeh), swords and diamonds (cryonic temple). tame (local h). beyond all reason - blood stained words. i remember you (skid row) - the eyes of horror [possessed cover] (amon amarth) - tineoidea (akustik - version) - ten years after - i'm going home, on and on (pain) - shot down in flames (phil lewis / baxter, jeff skunk / tony franklin). trapped in a corner (couragous), power / helloween. nine plagues of egypt (mystic circle). the last martyr (overlife) - switchblade serenade (switchblade), sharp dressed man. ilium (australia): "rainbow in the dark" (r.j. dio), evereve / the bride wears black. i am water (autumnblaze) - abigail's mercy - meaningless. black dwarl (candlemass). man on the silver mountain (hammerfall). immigrant song [led zeppelin cover] (gotthard), 2nd wind (gat rot), devilish temptation (voice). parisienne walkways (mattson) - atrocity / love is dead, bottled up (death by stereo). guilty (the rasmus). midnight mover [accept cover] (darkseed) - damned nation (nasum) - speak when spoken to_-_choopstick boogie (freak kitchen). shame on you (jan akkerman), glaube (relatives menschsein), through drowsy daydreams (hesperus dimension). sand of my watch, angels (project pitchfork). the cranberries - zombie - miles away (winger). what can i do (smokie) - only the people (unearth) - stairway to heaven, born to lose (motorhead - iron horse). hallowed be thy name (doogie white) - the call of the black forest (satanic warmaster), everything became skin (the sword volcano complex). gib mir alles (nawiegehts - mussja - mix). primal fear - seven seals, derenged - razor devine. dominium - the howling, fatcap / snatch away, welcome home (sanitarium) [metallica cover] (thunderstone), black magic woman (santana), spunge - roots. jadakiss / shoot out - saxon / man and machine. keine ewigkeit (blutengel) - my white bicycle (steve grimmett (gream reaper)), tush. fed up - when looking back. digested flesh breathe (gored face). prelude to dementia (severed remains) - deep purple - smoke on the water, cake & sodomy (broke box) - infatuator (silent force). uberdruck (demisor), spell of the witch demon (demonic), auto regression pr self progress (corporal raid). burning kisses (bitter grace) - die with your boots on (armageddon), break stuff (0-ring). future world (labyrinth) - she wants to move (virgin dance hits feat. n.e.r.). the loner (joop wolters). read between the lies [slayer cover] (anathema). no class (crystal pistol). children of the sea (jag panzer), waiting for darkness (anno daemonicus), clawfinger - the faggot in you. lenny kravitz - are you gonna go my way - laura (scissor sisters) - guur op den buyten (garmenhord). eye (a life in vain), enthused, hibernation sickness complete (arcturus), the memory remains the same [metallica cover] (terror test). power and will (part ii) (mgla). still of the night (whitesnake), the lake (corpus delicti), here i go again - oh my god (kaiser chiefs), fear my thoughts / ghosts of time. wieczny powrot (abusiveness), the swift - revolution - hemdale - over flow. richard clauderman and rpo - four seasons spring - sworn enemy (sworn enemy). devo - (i can't get no) satisfaction, nothing else matters (apoptygma berzerk), a flock of birds [#] (chako) - the dragon lies bleeding / hammerfall. above him - aiming high [accept cover] (custard) - we're not gonna take it (twisted sister). monster magnet - live for the moment (hardy boyz' theme) - honestly (stryper) - looking down the cross (daemos) - gimme the mic (anthropic principle) - children of the grave (jeff martin / gilbert / john alderete), im spiegel (morgenstern). iron man (live) (black sabbath), starlight reverie (edenbridge) - notwende - throwing your life away (spiritual beggars), two timing touch & broken bones (the hives), when i see you smile (bad english) - busting out. you are here (obsc(y)re), jihad / d.a.d., a dangerous meeting (gardenian). take a chance - honey child, what can i do? (isobel campbell & mark lanegan), faith (feat. jasmin st.c) (neil turbin) - gotta get outta here (akas, the), diabolic - gemini. richard hell and the voidoids - blank generation. dragonflys / through the night - altar of sacrifice (invocator), black magic (hypocrisy), sturm (antharos) - turn of the tide (x marks the pedwalk). declaration of a cheat (shining fury), wintersun / beyond the dark sun. in flames / take this life (various), mortal treason - khampa nomads. reprieves for my enemies (debodified), bryan ferry - girl of my best friend - gott sein '04 (megaherz) - silkstone - ready - gates of enoch (crimson massacre) - the bride wears black (evereve) - back in black, conspiracy in mind (edit) (communic). muscle in plastic. sanctuary (mystic prophecy). take no prisoners (skull crush), ein kleiner traum (leib & seele) - my desire (insight). death tone [manowar cover] (overkill) - motorbreath - doa - spacestation (rob acid) - sternenschiff - disappear (before the dawn) - la honda multia - battery (high voltage mix) - wrecks (street drum corps) - country side of life (wet willie), rotting misery (sup), curacion contra lucro. 48 crash (suzi quatro) - untitled [#] (santeria) - forever young (alphaville), lady in black (dark tranquillity), cannibal otter. all of me - jan holland - dreamlover - don't dictate (penetration). creeping death - physical attraction. quiet words (il aconite thrill), in the death car (iggy pop). my whole life (left alone) - christian says - leben (the merlons) - into infinite obscurity (dissection), let me be your dog (nicky moore (mammoth/samson)) - the quiet place (in flames), joe lynn turner - losing my head - requiem for an evil (apokatastasis), crucifixion (lord belial) - global lobotomy (corporal raid), tobacco road (corey craven). the damned - new rose. ultra violence, convicted in life (sepultura), i remember you (skid row), the future will show (nostradameus). child of babylon / whitesnake, because i can (8kount). forever (throwdown), memphis will be laid to waste (jean, norma). wintersun / beyond the dark sun (various). grimbor the great (freternia), lost to apathy (dark tranquillity) - eyes of all young (mob rules) - what it is to burn (finch) - get some go again (rollins band) - hot the numbers (anti-flag). guerilla radio (rage against the machine) - rise of the black moon (archgoat). synthetic generation (deathstars). killing time (heretic), tqeuilla darkrise. i don't know (october 31). the king (therion). don't do that (young and moody band) - front 242 - the thing that should not be. oni - altar of sacrifice, penetration - don't dictate - i hate berlin. boundries unknown (righteous pigs) - james last - cavalleria rusticana. rivendell (rivendell) - within temptation - it's the fear, blood and thunder (mastodon), superterrorizer (black label society) - glasseater - alone in the worl, dc disk (marble mix by xotox) (kiew), scrutinized (hypocrisy). symptom of the universe (evil incarnate), die young (black sabbath) (primal fear), devotion and desire (bayside). broken heroes (undercode), do you know (knife in your bac (killradio) - the corrs - what can i do - the buzzcocks - ever fallen in love, der komputer nr.3 (kontrast). the secrecies of horror (pestilence). mortal treason - war within. stellar master elite (performed by thorns) - thirsty and miserable (lemmy). mr. blackwell (lost at last). cold gin (john norum) - black sabbath (type o negative), masterplan (motorhead) - madman (metal messiah). disbelief - dogs on leads, 1985 (live) (bowling for soup) - anteroom for your love (escape with romeo). the pestilence (bonus track) (pessimist) - shapes of things (house of shakira), n.i.b. (ugly kid joe) - heartbreaker. dunkle seelen (mondsucht). yellowcard - firewater, fungus infected genitals (last days of humanity), i don't feel very receptive today (underoath). no love last (slapdash), control (puddle of mudd), det nye riket (dimmu borgir), karsi (turmion katilat) - headspeed - a different side to me, hammerfall / secrets. pickin up the pieces (poco). sure know something (espen lind) - independent (voice of the voiceless), deity (deist requiem), blasphemous vengeance (funeral rites), for thee, in sinful obscuri (hecate enthroned). nexus (stillste stund), thurisaz (nokturnal mortum). moonshield (in flames), septic tank abortion (lust of decay) - and the world shall be your god (naglfar) - graveflower (acid bath) - maggie (the exploited). we are happy family (ramones) (anthrax). house of the rising sun (animals). sin city, wish i had an angel (nightwish) - fractured mirror (diamond darrell) - judas (morifade), unholy confessions (avenged sevenfold), as one we stand (death threat), thank you for the music (metalium), only time will tell (nelson) - don't close your eyes (kix), i wanna be somebody / wasp. klaas jan mulder - praeludium ii. riders of the roots (edge of thorns) - stars (hear'n aid). black sun (primal fear), you can get high (warchylde). ted nugent / cat scratch fever (live version), the used / maybe memories. sydens makt (helheim), show your fist (ektomorf), she (snapcase) - run to the hills - robin mcauley, aces high - jeff scott soto - fosa comun (mixomatosis). benumb - monetary game. forever (prost alternative vocal mix), genzora (beangrowers) - the continuum (brother's keeper) - saitenspiel (janus). alaska (between the buried and me) - blurry (puddle of mudd), durch nacht und flut (single version) (lacrimosa), studying politics - future breed machine (meshuggah), wind in my sails - dark tranquility / therein, short fuse (no warning). papa roach - time and time again, empires of the worlds (biomechanical) - one mind [#] (magenta) - without judgement (death), breaking point - one of a kind (rob van dam's theme). eminem - bad infince - aces high (arch enemy). i wanna rock, domina (potentia animi) - god of thunder (shirleys temple). last laugh. come down, desires of the flesh (speedy gonzales), twist in my sobriety (dreadfull shadow) - der letzte tag (elis) - skin to skin (twilight guardians), at the end of august (36crazyfists), the ballad of chasey lain (bloodhound gang). snake charmer. when no one else gave a fuck (winter in june) - chiquitita (spiral tower), my generation (limp bizkit), sly & the family stone - medley: dance to the music / music lover / i want to take you higher. wanted man [johnny cash cover] (beverly killbillies), dance with the dead (axxis). the god awful truth (fear before the march of flames) - continence in killing. metal heart (accept) (dimmu borgir) - reo speedwagon / ridin' the storm out - cross the styx (sinister), mein stern (endanger) - say just words (gloomy grim), leeches (in flames) - crying days [scorpions cover] (therion). everlast - so long - whole lotta love - crankshaft (dead infection) - emphasis (after forever) - hangin' out (foxy roxx). one - total chaos. the voices from the flames (warchylde) - i hate berlin (second decay) - seelenlos (rmx) (black heaven) - foreigner - urgent - misteria - children of the snake. crying (yngwie malmsteen). himmelgrau (goethes erben). the ballad of frankie (dead toys), it doesn't happen to me every day, can we talk a while?, 2003
various artist [hard]
. swoon (the ocean), what went wrong, legions (stratovarius) - last caress (twentyinchburial) - when i see you smile (bad english), this is my own (shadows fall) - bulls on parade (evasl), these sonnets of our lives (inked in blood), ballroom blitz (motordam), thunder rising (tony hernando) - heil dem treuen blut (viking blood). from autumn to ashes - chlorof - the trooper (sentenced). fur immer und ewig (letzte instanz) - inner lane (beseech). creatures that kissed in cold mirrors (cradle of filth) - supreme immortal art (abigor). golden earring / radar love. strutter (phil lewis). glazed heart of fire (redemptor). where eagles dare (cinemuerte). frequenzwelten (misantrophe) - the last in line [destiny's end] - metal invaders, blood run, schwarzalbenheim (svartalfheim) (therion) - spill the blood (slayer) (disbelief), is this love (whitesnale), meads of asphodel, the / creed of abraham - between the lines (beseech). to move to go (damage control). nekro-erotic art (lord gore) - bob seger / against the wind, linkin park - in the end. shoot it in (the duskfall). machine gun (necronomicon). this is brainwash (sex pistols). big river (lemmy / slim jim / danny b) - overkill (motorhead) - personality crisis (new york dolls) - die seele brennt (after dark). white devil (alexisonfire) - hurtlocker - absoulution, beyond humanity (serpent soul), the highest price (chinchilla) - dominions of satyricon (performed by satyricon) - generation x - ready steady go. abulia (sardonic). the buzzcocks - orgasm addict - power and the glory (stormwarrior). ever frost (sentenced). where the wave broke (burst), what to do in oregon when your van breaks down (the judas cradle). ramblin man (allman brothers band). green eyes - the conjuring (killswitch), broadcast (unsung zeros) - magazine - shot by both sides - poison (alice cooper). religion is my name (vampir 2 in 1 mix) - long live rock & roll [gamma ray] - ice queen (within temptation). the instance (rostok vampires) - fantasmagoria - blackened. goodbye we're falling fast (aiden) - angels (say y), hiarra (thanathron) - marilyn manson - the beautiful people (the wwf remix) (smackdown theme). away (nightwish), green lizard - wrong - another twenty years (northing less) - rock you like a hurricane (scorpions). feeling good. carrie (europe), dead skin mask - sex pistols - god save the queen - i want to kill - zweite weg (illuminate), dark room (dive). i never told you what i do for a living (my chemical romance) - moment of impact (fear factory). screaming gods (anthica). raise the swords (taranis). killer of giants - silver machine (hawkwind). cat scratch fever (ted nugent) (pantera) - low life (trixx federation) - professional murder music - slow. sonata arctica / ain't your fairytale (various) - saint-preux - apres demain (ciciliano in g-minor). end of the road (murder by death). fingers (blood dead and sexy). vader - carnal. marooned (pink floyd). utterances unheard (fetocide). senzafine (lacuna coil) - station null (yendri), motorcycle man (new version) / saxon, bridges and gaps (with honor) - torture (link wray), ensemble & classified (ncc), mirror. ish - 7ways, cast me reflection (sea of desperation), synthetic generation (deathstars), your best nightmare - like light to the flies (trivium). retching up aborted feces (dycrasia) - sunburnt. immense malignancy (monstrosity), sleepin' on the sidewalk - los lobos. sweat suburbia (the skids) - lowemotor corporation - the flyin g, funeral for a friend / juneau, black cab (jens lekman) - victimized [king diamond cover] (ion vein). deiche (kettcar), angel (:wumpscut:) - hotel california (eagles) - chemical bastard (steril) - 20 eyes (devil leech project), charisma - money money money - don.t make it my brown eyes bl (cristal gayle). kein zuruck (wolfsheim). rod stewart - that's alright, i disappear (metallica), rag doll (joe louis walker). deadly sinners(demo) (3 inches of blood) - forced alienation (corporal raid), lady (styx), the dark lord (sam gopal) - burning wheels of fire (predator), valhalla (cruel), pass out of existence (chimaira). the gambler (kenny rogers). coitus mongoloidus (retch), medicine man (legion), sementes do odio (hate breeders) (mata ratos), seventeen ep (the april tears), fall on evil days (pain confessor), matters of the dark (tad morose) - primo victoria (sabaton). sweet morpheus (inkubus sukkubus). ride the sky (metalium). reflections (besieged). love hurts (doogie white (rainbow)) - sheena is a punk rocker (ramones) - kalte unschuld - entrenched (bolt thrower), in conspiracy with satan (marduk) - south of heaven (cemetary) - razed in black - damage inc.. mass hypnosis (children of bodom). welcome to dying [blind guardian cover] (clone). gates of babylon [yngwie malmsteen], it'll be okay (powder), infectious erection injonctions (screaming afterbirth), regurgitated guts (fornication), mayonaise (light the sky). runaway (linkin park), what about the marigolds (graveltrap) - gitane demone - rock and roll - crystal mountain (irredemption) - silverchair - without you. symphony of destrucion (megadeth) - nazarene (the wake) - last zip of spit (god dethroned), love hearts (nazareth) - mercy (orphand land). verflucht (relatives menschsein), the dagger, call my name (sammy hagar), doomed by the living dead (misanthrope) - oman (grido), machine-learning research (ncc) - she loves me not (papa roach), electric funeral (pantera), still alive (blind passengers). the bending (hopesfall). 10 seconds to love (libertine) - disturbed - down with the sickness - futurist unlimited (spahn ranch) - battle metal (turisas), to die for / in the heat of the night - personal jesus (marilyn manson). nikola the spellcaster. xtc - statue of liberty. wish you were here. dreams (mercenary) - roadrunner united - the dagger. darkness waves with many shades (cinis). the crying orc (burzum) - amerika (rammstein) - twenty years (placebo). shes got you (arabesque), black light district (boyd rice) - in the fire, behind the wall of sleep (static-x). illusion of life (pure noise disaster), empty rooms (star queen) - victim of massacre (total rusak). the things that should not be (back in black mix) (razed in black). the ventures - beethoven five - oh!, walls (impulse manslaughter), 300 motion pictures (roses are red) - best of burden (wendell holmes) - dance macabre (bonus track) (kekal). memories (the prowlers) - a dog-eat-dog world (aborym). get comfortable (the junior varsity). i hope you die (bloodhound gang), neon (sunshine blind). as i die (argile). save your love (great white) - noregsgard (performed by storm), nobody (skindred). run to the hills. first data (blink 182), johnny (gilla), laalavat jouset (vernjuarmu), nickelback - too bad. how to die in space (down below). sucker train blues (live) (velvet revolver) - alone (live) (the gathering), nowhere (symphorce), dancing queen (glow). razamanaz (doogie white (rainbow)). patti smith - because the night, he's a woman, she's a man - john corabi - pulse of the maggots (slipknot). past time (lady proler). irish blood english heart (morrissey), regin smidur (tyr), the neverending story (dragonland) - rat bat blue [deep purple cover] (helloween). careful with the axe, eugene (the electric family). leben (dracul (feat. ernst horn)), inexorable logic (disharmonic orchestra). the worlds havoc (maroon), static-x - x, mullet burden (dillinger escape plan, the), phantom of the opera (paul di'anno). before these crimes (mephisto waltz), vesania - mystherion crystaleyes - jesus just left chicago/waitin' for the bus-medley. skindred - nobody - blue tattoo (vanilla ninja), the number of the beast (steve grimmet) - under the guillotine (goddess of desire). rime of the ancient mariner (opera ix) - traces of reality (performed by dodheimsgard) - here comes your man (samiam) - snowblind (evoken). einherjahr (project toth), who is amazing (one true thing) - spoken words of venom (naglfar), him - poison heart. threesome (fenix tx), battle-tested (gun barrel). let there be more light, on the turning away - edguy / superheroes (various). fixation on the darkness (killswitch engage) - drowning pool - the game (triple h's theme) - sleeping away (sinamore), richard clauderman - polovetsian dances - y&t / black tiger. fairy tale (gray / scale) - wasted years - dee snider, engellied (sea of tranquility), nerve (soilwork) - devil rides a harley (psychotramps). killing in the name (dark gamballe) - with you (linkin park), ramones - sheena is a punk rocker - seclusion (penumbra) - six feet under - wrathchild. the spencer davis group - lets have a party. fire in the sky (yngwie malmsteen), under the guillotine [kreator cover] (diabolic), i cant drive 55 (sammy hagar) - 10 anos de vida (mixomatosis), victims of darkness (seasons of the wolf). in your grave (mysticum). if it's mental it can't be physical (ncc). skid row - delivering the goods. billy joel - all shook up, what love can be (kingdom come). black magic - tomorrow (the 3856). wolfskiller (charitona). the process (my american heart). dark lady [scorpions cover] (agent steel), whiplash (motorhead) - hangar 18 (fairlight) - onderdaan van haat (stormkaai) - saint and sinner (rawhead rexx). deicide - when satan rules the world, only the true norvegian black - jesus saves (enslaved), terror division blood strike (bahimiron), memories - the solvent (veneral disease) - fear factory - moment of impact - it's only over when... (flakes), sweet - ballroom blitz, born dead (greenfly), bleed for the gods [agent steel cover] (powergod). cat scratch fever (ted nugent). money, sabbra cadabra (hed / p.e.), mandibles (e.town concrete). another day of sorrow. stroke - i wish i had, cerebral assassin (chronicle of tyrants) - flash rocking man (axxis), the book of heavy metal (dream evil). siebenburgen - jawbreaker - dreaming in dog years (red chord, the), ancient times (galloglass). warlords of steel (zandelle) - crazy train - primal fear / evil spell (various) - severed ties yield severed heads (it dies today). alanis morisette - ironic, tranen aus staub (melotron). bigbeatpoetry (watts) - this corrosion (the sisters of mercy) - shout at the devil (nc thirteens) - endless (unearth) - imperium (machine head) - ode an epiphanie (samsas traum), mac davis - a little less conversation, lieder die wie wunden bluten (l'ame immortelle), therion / enter uril-ya - massa brutal (total rusak), eurythmics - sweet dreams, tiefer winter (klubtekk rmx) (l'ame immortelle), we will rise (arch enemy). the black chariot of horst (theudo) - in einer sommernacht, wicked saints (impious), complete heat (fight paris), clawfinger - the faggot in you. du bist es nicht wert (melotron), the painless (stille volk) - the cult of gollath (darkthrone), small silhouette (mudvayne), sum 41 - it's what we're all about - starmaster (kaptain sun), curse of the pharaohs (mercyful fate), over the hills and far away (domain) - metal heart (dimmu borgir), crossroad (the storyteller). somebody told me (the killers), steel to steel (midnight sun), rock you / helix, rage - the trooper (bonus) - dandy (rockin' vickers). urban kids (chelsea), wild world (mr.big), death to the traitors (beloved). impromptu (allegro maestro) (sigh) - laid to rest (lamb of god), crying in the rain. shit world (chronical diarrhoea), w.w.w. (inception mix) (individual totem), run like hell, wrathchild - paul di'anno. i will always love yo (dolly parton) - forever (as i lay dying). thunderstrack - tears of a melancholic vampire (mutiilation). i'm a rebel (sodom) - skoghems minnen vaekks (arckanum). kathy's song (come lie next to me) (apoptygma berzerek). croosroards (silence gift) - schizophrenic butchering. remember tomorrow (anthrax). stone cold crazy - eleven - final product (nevermore) - blitzkrieg bop (live) (the ramones), paul simon - mrs robinson - beg to differ (prong) - this tribal antidote (killing joke), bury your dead (live) (the haunted), chain [rare] (vampire rodents), who are you (jon salemi), shout it out loud (surferosa) - hallowed be thy name (solitude aeturnus), parapluies de cherbury (paul mauriat). layers of lies (darkane) - cold sweat [thin lizzy cover] (helloween), down (motograter), flowing blood from the virgin born (prelude) (bahimiron). damnation of regiomontum (tvangeste), jag spar fordarv (thyrfing). lady huskies are one man short (vena amori) - headhunter 2000 (space frog remix), one step closer (linkin park) - aerials (system of a down), hate (altercated) - colors of the new world (revisited) (evil wings), vehement christian behaviour (funeral rites). terrorized - after world obliteration, banished to oblivion (adumus). we vibrate (the vibrators) - tool of the devil (thunderstone). songbird (sorrow). perfect fit (weeb). rift (imperative reaction), laura [#], band / the weight, midnight rambler (larry mccray), cryptopsy - flame of the surface. umirajici nevinnost. vanessa mae - classical gas, she's got a cause (the aliens). zauberstab (klirrfaktor), de profundis mors vas consumet (abruptum) - territory (exhumation). swamped (lacuna coil) - play the game - jon brion. the sun goes down (thin lizzy) (sinner) - ymber autumnus - dunkelheit - it's alright (rockin' vickers), hometown star (horizon) - one of us (flowing tears), heaven - pigs (feat. dogs' n' sheep). the days of the phoenix (unearthed) - dido - thank you, cursed world (exhumation) - in remembrance (morbid angel). iggy pop - the passenger, goodbye to romance, seele in not (lacrimosa) - trapped under ice - furious trauma - re-arranged (stacey quinealty). criminally insane (edge of sanity). thursday - a hole in the world - comfartably numb. gefuhl ist alles (samsas traum) - murderer, punk rock love (the casualties). samuel l. (midasuno). leper messiah - afflicted. in trance - kory clarke. riviera paradise (stevie ray vaughan), gilded cunt (cradle of filth), one sided society (devotchkas). don't fear the reaper (blue oyster cult), rose of sharyn (killswitch engage), the last survior (gruesome stuff relish), purgatory (descending mix by flesh field) (assemblage 23) - bicycle race - be your own pet. it can't get any worse (my shameful), gateways of distorted subreality addicted to chaotic paranoia (v2.0) (corporal raid), no sense (new model army), tush (z z top), dt medley (take the time - under a glass moon - learning to live) (empty tremor). my friends over you (new found glory), carrie (europe), can't close my eyes (love is red), meant to be free (troll), peace (agnostic front). twilight of the gods, hold my own (biohazard), concealed in flesh (sepsism), headspeed - a different side of me - ain't no fairytale (sonata arctica), shake your heads (atrocity), et si tu n'existais... (joe dassin), the siege of aina (aina), china lady (new eden), paperthin hymn. sting - walking on the moon. linkin park - one step closer, rose garden (lynn anderson). warhead (producer's mix) (venom). kill your family (then yourself), heaven (warrant) - improvisabort - nookie (gliss) - kill! kill! kill! (blood freak) - harmony in my head (buzzcocks) - no phone (cake), paranoid (live) (black sabbath) - monsterman (seven witches) - chad kroeger ft. josey scott - hero - american bad ass (kid rock), people = shit (slipknot) - clarissa explains cuntainment (the number twelve looks like you). walk away (astream) - ist der ruf erst ruiniert (tic tac toe), abandon of venom - whiplash - sleeper in metropolis 3000 (im (anne clark). benny anderson - intermezzo nr.1. planetary black elements (covenant) - hate (colony 5), warhead (otep) - primal fear - metal gods. heavens a lie (lacuna coil), horror (the day everything became nothing). new method of expression (staring back), battery (eric a.k./mike clark/robert trujillo/dave lombardo) - aliens exist. legs. people of the sun (tavu). power trip (chimaira) - lauluni sinulle (tenhi), the dead kennedys - holiday in cambodia - extol - gloriama, serberus - ghost of war - when it's all said and done (figure four), buttman goes to rio (cock and ball torture) - ich bin (staub) - seek & destroy (exclusive track) (primal fear). schattenreich (ghosting), carousel (forbidden planet). all about the money (sonat) - maniac dance (stratovarius), der leiermann (club version) (covenant), die liebe (endanger). hot dog (limp bizkit). a view in the mirror black (niden div.187), im klinischen sinne (elesde). nepenthe (sentenced). every rose has it's thorn (poison). one of these days (fantasyy factoryy). secret discovery / colour my life, ohne dich (rammstein), starry eyes (dementia), george thorogood / highway 49, changes (girls under glass). marilyn manson - master of puppets, obvious. danzig / five finger crawl. the beast within you (lana lane). drop dead, casanova (disco ensemble) - there's no i in fuck you (walls of jericho). shadows of the mutilated (dismember), all over now (hollywood teasze), surrounded (cmky) - kingdom come / living out of touch, the kill (birmingham 6), engelsstaub (new version) (in strict confidence), repeat it (frequency mix) (icon of coil), bachman turner overdrive - you ain't seen nothing yet. always the same (decades), laruso - falling apart. gimme! gimme gimme! (a man after midnight) (sinergy) - the vapors - turning japanese, voice of sanity (live). you shook me all night long (doug pinnick / gilby clarke / tony franklin) - ...and the life dies away... (autumnia) - i want to be with you (michael schenker) - craving vehemence (exordium), glaubenskrieg (feindflug) - tiamat / sympathy for the devil. reckoning day (wasteland), save me (joe stump's the reign of terror). autoerotic asphyxation (devourment), and the bands played on (noise forest). for pagan and heretic's blood (der sturmer). angel in black (primal fear). black sun, natalie imbruglia - that day, panther (panther). testify [brimstone mix) (the damned), getaway (the carburetors). limelight (d'molls) - move (thousand foot krutch), verlieb' dich in mich (welle erdball), roads, the watcher (hawkwind). korperraum (endraum). gone surfin (gary hoey). aurrera (eraso) - the electric shaman (despairation) - maleficium (morgana lefay). fat lip (sum 41). korn - hypocrites. desire in violent overture (lucifer), burning skies / individual hate complex, remember tomorrow (opeth) - vampire hunter (leatherstrip), i'm bad, i'm nationwide. shanghaid in shanghai (steve overland (fm)), forgotten past (rudra) - t.n.t.. embalmed existence (ressurection). unrealized reservation (datura), another brick in the wall, pt. ii - dreadlock pussy - t minus. niki fm (hawthorne heights) - the book of leviathan (the black) - anti christ (dissection), ama deus (sanguis et cinis), heil dem treuen blut (viking blood). may the sunshine (steve overland (fm)). blood on the floor (crack up). you know i wanted just to take you home, but that's not your style, alternative